PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009129401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 132aa    MW: 14678.5 Da    PI: 7.4056
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009129401.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.89e-4412110199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C++dCv+apyfp ++p kfanvh++FGasnv+k+l+++ +++red+++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el+
  XP_009129401.1  12 PCAACKFLRRRCTSDCVFAPYFPPDEPTKFANVHRIFGASNVSKILHEVAPHQREDTVNSLAYEAEARLNDPVYGCVGAISVLQRQVLKLQRELE 106
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_009129401.1 107 ETNA 110
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.90811112IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MASSYSNYIN SPCAACKFLR RRCTSDCVFA PYFPPDEPTK FANVHRIFGA SNVSKILHEV  60
APHQREDTVN SLAYEAEARL NDPVYGCVGA ISVLQRQVLK LQRELEETNA DLMRYASSLG  120
GEMTSNYGGH RG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129401.12e-96PREDICTED: LOB domain-containing protein 25-like
RefseqXP_013697798.12e-96PREDICTED: LOB domain-containing protein 25-like
RefseqXP_013697803.12e-96PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q39e-86LBD25_ARATH; LOB domain-containing protein 25
TrEMBLM4EW362e-96M4EW36_BRARP; Uncharacterized protein
STRINGBra033019.1-P7e-96(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-87LOB domain-containing protein 25