PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009129079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 583aa    MW: 62066.6 Da    PI: 8.3236
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009129079.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14128167141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  XP_009129079.1 128 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 167
                     589**************************.********986 PP

2TCR512.8e-16213251139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN 
  XP_009129079.1 213 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCLDCKNF 251
                     589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16128168IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.136129253IPR005172CRC domain
PfamPF036387.3E-11130165IPR005172CRC domain
SMARTSM011145.3E-19213254IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12216251IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MGEGGGGGGE FPPKKEGVTD ESGFPAKTPA RQLDFTGGSA EHSLSKPAPP TVVATVVKTI  60
ATPSVSSSPI TTTMASRLHP VVRPTVPVVA TNSPSQSQIV NAPIRHPKPE SPISRARPIV  120
EGRDGTPQKK KQCNCKHSRC LKLYCECFAS GTYCDGCNCV NCFNNVDNEP ARRDAVEATL  180
ERNPNAFRPK IASSPHGVRD KREEIGEVVL LGKHNKGCHC KKSGCLKKYC ECFQANILCS  240
ENCRCLDCKN FDGSEERQAL FHGEHANNMA YLQQAANAAI TGAVGSSGFA PSPAPKRRKG  300
HDISFNQATK DSSTHRLGQF QQGNNGRTSG PTSGTSPATV SRPGGTSSAA PSKFVYRSLL  360
ADIIQPQDVK ALCSVLVAVA GEAAKTLTDK RNETETCLAS SAQDNSQGNK DVEMVAADAN  420
QADKSGPEGS NSDASKGNPL SPATLALMCD EQDTIFMVAA AEPNGSVDPG GCGKNSQEQS  480
EIYAEKERVV LTKFRDCLSR LISYAEIKES KCSYLARRHI QPPPTASATV KTENGIQQIP  540
EPRTTAQPTL TKPQPLQPTT TTNTSTTQHP HKPQALPEKK DST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-3113026211132Protein lin-54 homolog
5fd3_B5e-3113026211132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009129079.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129079.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A398AQR20.0A0A398AQR2_BRACM; Uncharacterized protein
STRINGBo1g016960.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein