PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009128835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 318aa    MW: 35371.9 Da    PI: 7.0313
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009128835.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.8e-1851111257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  XP_009128835.1  51 KPRWNPKPEQIRILESIFNSgIVNPPREEIQRIRTRLqeygQIGDANVFYWFQNRKSRAKH 111
                     89*****************99*************************************995 PP

2Wus_type_Homeobox111.73.9e-3650112264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P++eeiqri+++L+eyG+i+d+NVfyWFQNrk+R ++k
     XP_009128835.1  50 PKPRWNPKPEQIRILESIFNSGIVNPPREEIQRIRTRLQEYGQIGDANVFYWFQNRKSRAKHK 112
                        579**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.39847112IPR001356Homeobox domain
SuperFamilySSF466899.84E-1248114IPR009057Homeodomain-like
SMARTSM003891.3E-649116IPR001356Homeobox domain
CDDcd000866.48E-850112No hitNo description
Gene3DG3DSA:1.10.10.602.4E-651110IPR009057Homeodomain-like
PfamPF000461.5E-1551111IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MSSSNKNWPS MFKSKPCNKH HHRDMETPSS MPYSNCNTPS PFSSDRVPDP KPRWNPKPEQ  60
IRILESIFNS GIVNPPREEI QRIRTRLQEY GQIGDANVFY WFQNRKSRAK HKLRVLKKNP  120
KMLGCNPSKT RKEKIITPND NPTDPCFGLV NHETGLFPGQ NNELVITEPA SFLYPDDNNP  180
SLTQSGFGFG GFVVPVVAEE RLELAGTSNG LNMNIPEIDF GGGENGYFPN SVPVTVPLTI  240
NQSQVSSGGG DIGDYVSPVR LTVFINDMPF DVAAGLFNVK EAFGNNAMLI NSFGQPILTD  300
EFGVTFQPLQ NGAVYYLL
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the egg cell and the central cell of the embryo sac (PubMed:14711878). After fertilization, it is expressed in the zygote (PubMed:14711878). After the first division of the zygote, it is detected exclusively in the basal daughter cell, while WOX2 is expressed in the apical daughter cell (PubMed:14711878). Through the 16-cell stage, it is expressed in all descendants of the basal daughter, the developing suspensor and the hypophyseal cell (PubMed:14711878). After the hypophysis had divided, expression stops in descendants, but remains present in the extra embryonic suspensor (PubMed:14711878). Moreover it is found in the cellularized endosperm of the micropylar region during the globular and heart stages of embryogenesis (PubMed:14711878). Not expressed later in embryogenesis or in postembryonic stages (PubMed:14711878). Activated in the zygote after fertilization (PubMed:21316593). {ECO:0000269|PubMed:14711878, ECO:0000269|PubMed:21316593}.
UniprotTISSUE SPECIFICITY: Expressed only in the egg cell (PubMed:21316593). Not detected in the pollen tube (PubMed:21316593). Expressed in the zygote, the basal cell, and later the suspensor (PubMed:21802295). Expressed in all suspensor cells, except the hypophysis, and in the embryo surrounding region (ESR) endosperm cells (PubMed:22427333). Strongly expressed in the suspensor cells, with a weak expression also detected throughout the developing embryo (PubMed:22827849). {ECO:0000269|PubMed:21316593, ECO:0000269|PubMed:21802295, ECO:0000269|PubMed:22427333, ECO:0000269|PubMed:22827849}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor, which may be involved in embryonic patterning (PubMed:14711878). May be required for basal embryo development after fertilization (PubMed:14711878). Acts partially redundantly with STIP in promoting embryonic cell division and proliferation (PubMed:17706632). Promotes cotyledon boundary formation by maintaining the symmetry in CUC genes expression domains (PubMed:22827849). {ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:22827849, ECO:0000303|PubMed:14711878}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009128835.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2 (PubMed:21316593). Up-regulated by CLE8 (PubMed:22427333). {ECO:0000269|PubMed:21316593, ECO:0000269|PubMed:22427333}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128835.10.0PREDICTED: WUSCHEL-related homeobox 8
RefseqXP_013646635.10.0WUSCHEL-related homeobox 8-like
SwissprotQ6X7J51e-153WOX8_ARATH; WUSCHEL-related homeobox 8
TrEMBLA0A398AG270.0A0A398AG27_BRACM; Uncharacterized protein
STRINGBo2g127670.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142621619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.11e-145WUSCHEL related homeobox 8
Publications ? help Back to Top
  1. Xiao W, et al.
    DNA methylation is critical for Arabidopsis embryogenesis and seed viability.
    Plant Cell, 2006. 18(4): p. 805-14
    [PMID:16531498]
  2. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  3. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
    J. Exp. Bot., 2014. 65(22): p. 6543-52
    [PMID:25205582]
  4. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]