PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009127598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BBR-BPC
Protein Properties Length: 278aa    MW: 31347.6 Da    PI: 9.857
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009127598.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind297.45.7e-9112781301
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki..rernlalsekkaav............aerd........maflqrdkalaernka 73 
                     md+dg  +rn+gyy+++ +++  lg+ql+ si +r++k+    +n +++++++ +             +rd        m++    ++l++    
  XP_009127598.1   1 MDEDGLSNRNWGYYDQS-QFRPSLGFQLIPSIVDRNDKQflFPQNPNFITTNNGYcgggssssnvmsFPRDytasdapfMSY----SWLNQ---- 86 
                     9**************99.********************99945555557777777566665555554444466665555555....77777.... PP

       GAGA_bind  74 lverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkk 168
                       +rd+k++++l+++ s ++++       + ++ ++ lq                      +p   +++e+ +++++  +q  ++pk+kk++k +
  XP_009127598.1  87 --HRDSKFFNNLPNNPS-NHHT----LLDPRAQPMQLLQI--------------------PKPEAGEVDESLKRRQCGGGQ-RADPKAKKERKLR 153
                     ..999999999994443.1111....12222222222222....................222244577788888998555.5689999988888 PP

       GAGA_bind 169 kksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqg 263
                     +        +  +++++++   +ksi++v+ngv++D++ lPvPvCsCtG ++qCY+WG+GGWqSaCCtt++S+yPLP++tk+rgaRiagrKmSqg
  XP_009127598.1 154 D--------NIVPRMQRERSPLRKSIEMVINGVTIDIGCLPVPVCSCTGLSQQCYRWGCGGWQSACCTTNVSMYPLPMNTKKRGARIAGRKMSQG 240
                     8........2334444566789************************************************************************* PP

       GAGA_bind 264 afkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     afkk+LekL+a+G+d+s p+DLk+hWAkHGtnkfvtir
  XP_009127598.1 241 AFKKVLEKLSADGFDFSSPIDLKSHWAKHGTNKFVTIR 278
                     *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.9E-1321278IPR010409GAGA-binding transcriptional activator
PfamPF062171.6E-831278IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MDEDGLSNRN WGYYDQSQFR PSLGFQLIPS IVDRNDKQFL FPQNPNFITT NNGYCGGGSS  60
SSNVMSFPRD YTASDAPFMS YSWLNQHRDS KFFNNLPNNP SNHHTLLDPR AQPMQLLQIP  120
KPEAGEVDES LKRRQCGGGQ RADPKAKKER KLRDNIVPRM QRERSPLRKS IEMVINGVTI  180
DIGCLPVPVC SCTGLSQQCY RWGCGGWQSA CCTTNVSMYP LPMNTKKRGA RIAGRKMSQG  240
AFKKVLEKLS ADGFDFSSPI DLKSHWAKHG TNKFVTIR
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in petal vasculature, in anthers, in young rosette, in the lateral and primary roots, and in the gynobasal portion of the ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009127598.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009127598.10.0PREDICTED: protein BASIC PENTACYSTEINE3
SwissprotQ9C9X61e-141BPC3_ARATH; Protein BASIC PENTACYSTEINE3
TrEMBLM4EYR70.0M4EYR7_BRARP; Uncharacterized protein
STRINGBra033959.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153471518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.11e-139basic pentacysteine 3