PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009127445.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 202aa    MW: 22093.8 Da    PI: 7.5609
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009127445.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.21.8e-4591081100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l+
  XP_009127445.1   9 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPSQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQIDLS 103
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      +k+e
  XP_009127445.1 104 CAKSE 108
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2018109IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-449106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MASSSTNSPC AACKFLRRKC QPECVFAPYF PPDQPQKFAN VHKVFGASNV TKLLNELHPS  60
QREDAVNSLA YEADMRLRDP VYGCVGVISL LQHQLRQLQI DLSCAKSELS KYQSLGILAA  120
THQSLGINLL AGANADGSTT ATVRDHHYHH HQFFPREQMF GGLDVPTGNN YDGGILAIGQ  180
ISQFQQPRAA AGDDGRRTVD PS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF5I140.0AC001229.1 Sequence of BAC F5I14 from Arabidopsis thaliana chromosome 1, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankBT0251630.0BT025163.1 Arabidopsis thaliana At1g65620 mRNA, complete cds.
GenBankAY5194830.0AY519483.1 Arabidopsis thaliana ecotype Blanes AS2 (At1G65620) gene, complete cds.
GenBankAB4738330.0AB473833.1 Arabidopsis thaliana AS2 mRNA for ASYMMETRIC LEAVES2, complete cds.
GenBankAB0808020.0AB080802.1 Arabidopsis thaliana AS2 mRNA for ASYMMETRIC LEAVES2, complete cds.
GenBankAF4478870.0AF447887.1 Arabidopsis thaliana LOB DOMAIN 6 (LBD6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013674850.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013674848.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013674847.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013674846.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013651824.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013651823.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013651822.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013651821.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013651820.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013741691.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013741690.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013741689.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013741688.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013741687.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013616633.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013616632.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013616631.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013616630.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_013616629.11e-151PREDICTED: LOB domain-containing protein 6
RefseqXP_009127447.11e-151PREDICTED: LOB domain-containing protein 6
SwissprotO044791e-127LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A078IA771e-151A0A078IA77_BRANA; BnaA02g12180D protein
TrEMBLA0A0D3AN841e-151A0A0D3AN84_BRAOL; Uncharacterized protein
TrEMBLM4FF611e-151M4FF61_BRARP; Uncharacterized protein
STRINGBra039733.1-P1e-150(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-129LBD family protein