PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009127147.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 347aa    MW: 37981.6 Da    PI: 8.6484
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009127147.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.94.2e-24105147244
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      epgrCrRtDGKkWRCs++v++++k+CErHlhrgr rsrk++e
  XP_009127147.1 105 LEPGRCRRTDGKKWRCSKEVVSNHKYCERHLHRGRPRSRKHVE 147
                     69***************************************97 PP

2QLQ51.23.9e-185687233
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33
                    +FT+aQl +L++Q+++yKy++a+ PvP +Ll+
  XP_009127147.1 56 PFTNAQLKELERQAMIYKYMIASIPVPFDLLV 87
                    9*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-105591IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-115686IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.1865691IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.629104148IPR014977WRC domain
PfamPF088791.7E-19106147IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MDFLKVSDKT TTPYRNNSLF GLSQQHMEIH PHPHPHPHVI TPHAGNGVMG CYYYYPFTNA  60
QLKELERQAM IYKYMIASIP VPFDLLVSSS SYAPPCNNKN AVGDLEPGRC RRTDGKKWRC  120
SKEVVSNHKY CERHLHRGRP RSRKHVELPY SRPINIGGGS EKNRVLSSIK DTTVVEPKEV  180
SSALANYRGL EIFPASASNE QENKYLNFID VWSDGVRSSE KQSTPASSSP NGNPSLYSLD  240
LSMGGNSLMG HDEMGLRVIG PGRDDPHGYG PYGGVVSSSL DEMSRWLAST SATPGGPLAE  300
ILRPNPSSAF SGEMEGNSLT ATPTPSSSPS RVVKKVTGSV SDDSSKI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009127147.10.0PREDICTED: growth-regulating factor 7 isoform X1
SwissprotQ9FJB81e-175GRF7_ARATH; Growth-regulating factor 7
TrEMBLM4E1L70.0M4E1L7_BRARP; Uncharacterized protein
STRINGBra022667.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121062731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-152growth-regulating factor 7