PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009126209.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 275aa    MW: 30435.5 Da    PI: 6.5719
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009126209.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.14e-152888257
                    T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    r+R+++++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  XP_009126209.1 28 RSRWSPKPEQILILESIFNSgIVNPPKDETVRIRKMLeqfgAVGDTNVFYWFQNRRSRSRR 88
                    89*****************99*************************************997 PP

2Wus_type_Homeobox106.51.7e-342790265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ar+RW+P+peQi iLe++++sG+++P+k+e+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
     XP_009126209.1 27 ARSRWSPKPEQILILESIFNSGIVNPPKDETVRIRKMLEQFGAVGDTNVFYWFQNRRSRSRRRQ 90
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-8689IPR009057Homeodomain-like
SuperFamilySSF466895.99E-142295IPR009057Homeodomain-like
PROSITE profilePS5007111.2562489IPR001356Homeobox domain
SMARTSM003892.1E-62693IPR001356Homeobox domain
PfamPF000469.1E-132888IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDQEGSSQSP TGQGRSPSAP SNSTAPARSR WSPKPEQILI LESIFNSGIV NPPKDETVRI  60
RKMLEQFGAV GDTNVFYWFQ NRRSRSRRRQ RQLQAATAAA VTSRGAEDQQ HMTTMSMHHP  120
YRNNEINLGF GSCSNSSANY FFNDPSSQVS SFLLGHSSSS SNGGCESNNG MENLFTMYGH  180
ESDHPHLHQH SSNDATISNP SDQNSSFHYQ QGLMTVFING VPTEVTEGAI DMKAMFGEDL  240
ALMHSSGLPL PIDEFGFLMH SLQHGQSYFL VPRQT
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009126209.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894500.0AC189450.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB071M18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126209.10.0PREDICTED: WUSCHEL-related homeobox 12-like
SwissprotQ8GY251e-124WOX12_ARATH; WUSCHEL-related homeobox 12
TrEMBLM4E4D50.0M4E4D5_BRARP; Uncharacterized protein
STRINGBra023638.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.21e-105WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]