PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009125677.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 319aa    MW: 35892.1 Da    PI: 9.5313
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009125677.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY941.1e-29130188260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrK GqK+vkgse+prsY+rCt+++C +kkkve+s   ++v+ei+Y+g+Hnh+k
  XP_009125677.1 130 EDGYNWRKDGQKQVKGSENPRSYFRCTYPNCLTKKKVETSLVKGHVTEIVYKGSHNHPK 188
                     7********************************************************85 PP

2WRKY104.65.4e-33242300159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+ +d k v++tYeg+Hnh+
  XP_009125677.1 242 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFTGCCVRKQVERAFHDAKSVITTYEGKHNHQ 300
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.4E-25123189IPR003657WRKY domain
PROSITE profilePS5081122.653124189IPR003657WRKY domain
SuperFamilySSF1182903.14E-23127189IPR003657WRKY domain
SMARTSM007741.3E-30129188IPR003657WRKY domain
PfamPF031061.3E-21130187IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-36227302IPR003657WRKY domain
SuperFamilySSF1182904.58E-29234302IPR003657WRKY domain
PROSITE profilePS5081136.208237302IPR003657WRKY domain
SMARTSM007741.2E-37242301IPR003657WRKY domain
PfamPF031067.7E-25243300IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070370Biological Processcellular heat acclimation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MASFNQQRSV PKFKSATPSP LPLSSYFSMP PGLTQADLLD SPLLFTSSNV LPSPTTGTFP  60
LESLNWKNNG LLTNRNEIKA EDGKEEHFDF AFTTIQTSPP LFLSHFQTED QRSTQVDVPK  120
FESSGNKTSE DGYNWRKDGQ KQVKGSENPR SYFRCTYPNC LTKKKVETSL VKGHVTEIVY  180
KGSHNHPKPQ FTKRSASTAA TNDVSSHQSG GEDNVDAKRG KREEAVKEPR VVVQTTSDID  240
ILDDGYRWRK YGQKVVKGNP NPRSYYKCTF TGCCVRKQVE RAFHDAKSVI TTYEGKHNHQ  300
IPNPKKTSHL NMISDCVSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-34130302877Probable WRKY transcription factor 4
2lex_A1e-34130302877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY25 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:21336597}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00494DAPTransfer from AT5G07100Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009125677.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (PubMed:11449049). Induced by heat stress (PubMed:21336597). {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:21336597}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300440.0KF430044.1 Brassica rapa WRKY transcription factor 26 (WRKY26) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288922.10.0probable WRKY transcription factor 26
RefseqXP_022550422.10.0probable WRKY transcription factor 26 isoform X1
RefseqXP_022550426.10.0probable WRKY transcription factor 26 isoform X2
SwissprotQ9C5T31e-150WRK26_ARATH; Probable WRKY transcription factor 26
TrEMBLM4EIU20.0M4EIU2_BRARP; Uncharacterized protein
STRINGBra028707.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.11e-152WRKY DNA-binding protein 26
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]