PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009125558.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 505aa    MW: 56510.7 Da    PI: 4.304
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009125558.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.32.6e-5291361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgkd+e+ 
  XP_009125558.1   9 LAPGFRFHPTDEELVRYYLKRKVCNKPFNF-DAISVADVYKSEPWDLPdKsKLKGRDLEWYFFSMLDKKYSNGSKTNRATERGYWKTTGKDREIR 102
                     579**************************9.99**************95346777777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv++kgrap+ge+++Wvmheyrl
  XP_009125558.1 103 N-GTRVVGMKKTLVYHKGRAPRGERSNWVMHEYRL 136
                     9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.15E-607159IPR003441NAC domain
PROSITE profilePS5100558.1989159IPR003441NAC domain
PfamPF023657.0E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MGRGSATSLA PGFRFHPTDE ELVRYYLKRK VCNKPFNFDA ISVADVYKSE PWDLPDKSKL  60
KGRDLEWYFF SMLDKKYSNG SKTNRATERG YWKTTGKDRE IRNGTRVVGM KKTLVYHKGR  120
APRGERSNWV MHEYRLTDDE LKIAGAPQDA FVLCRVFQKS GTGDKYGAPC LEEEWEEDTM  180
TFAPEQEALS EGLGVDDDVY LEKPESLVVY DAIPVQSNYC PGESSNNVES GNYEDCGNYV  240
VDFEQPIEEE EEEEQKPIIR DGSIQPCSLF PGEQIGCGVE DEKAVNLEAS NDNVFVADTC  300
YGDIPTDDAS YMPEEPFIED DFNFEDYLNF FDDEDAQNWS LDVSQLLGSE EGLDQKQPSP  360
EELEKEKESG EGSSSKQDAD VTDLDSASKH PFLKKGSHMF APPSFASSQF QTKEAAIRLH  420
AAQSSGSVHV TAGMIRISNM TTLAAESSMG WSYDKNGNLN VVLSLGLVQS KTGGTTATRA  480
MFIFMCFWIL LLYVSFKIGT IVSAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-44816516171NO APICAL MERISTEM PROTEIN
1ut4_B2e-44816516171NO APICAL MERISTEM PROTEIN
1ut7_A2e-44816516171NO APICAL MERISTEM PROTEIN
1ut7_B2e-44816516171NO APICAL MERISTEM PROTEIN
3swm_A2e-44816519174NAC domain-containing protein 19
3swm_B2e-44816519174NAC domain-containing protein 19
3swm_C2e-44816519174NAC domain-containing protein 19
3swm_D2e-44816519174NAC domain-containing protein 19
3swp_A2e-44816519174NAC domain-containing protein 19
3swp_B2e-44816519174NAC domain-containing protein 19
3swp_C2e-44816519174NAC domain-containing protein 19
3swp_D2e-44816519174NAC domain-containing protein 19
4dul_A2e-44816516171NAC domain-containing protein 19
4dul_B2e-44816516171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.76750.0flower
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009125558.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893880.0AC189388.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB053D06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125558.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A3P6A4T80.0A0A3P6A4T8_BRACM; Uncharacterized protein
TrEMBLM4EJ250.0M4EJ25_BRARP; Uncharacterized protein
STRINGBra028790.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]