PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009125288.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 314aa    MW: 35105.8 Da    PI: 4.6214
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009125288.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.48.5e-18205239135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  XP_009125288.1 205 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 239
                     99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.8E-993295IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.385199235IPR000679Zinc finger, GATA-type
SMARTSM004014.4E-17199249IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.95E-15202263No hitNo description
Gene3DG3DSA:3.30.50.102.4E-14203237IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.65E-15204251No hitNo description
PROSITE patternPS003440205230IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15205239IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEQQQQLTPE LFLVAGGNSD SFVVDDLLDF SNDNVQPDDG LEPFPDSSTV STGTLADSSN  60
SSSSFYTDGS VFSDDLCVPS EDLAELEWLS NFVEESFSKE DQDKLQLLSG LQKPQTTGLT  120
QTKPELEPEP ELDQIFIPTD TDDSNVSVPA KARSKRPRSA ASTWASRLLA IAGSDESYPK  180
KKQLRVKEHD GSTGELEGEV GERRCLHCAT DKTPQWRTGP MGPKTLCNAC GVRYKSGRLV  240
PEYRPASSPT FVMTRHSNSH RKVMELRRQK EMRDEHLMSQ LRCENLVMDI RSNGEEFLIS  300
NNNNNHVAPD FRHF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013666624.10.0PREDICTED: GATA transcription factor 9-like
RefseqXP_009125288.10.0PREDICTED: GATA transcription factor 9
SwissprotO826321e-165GATA9_ARATH; GATA transcription factor 9
TrEMBLM4D4I90.0M4D4I9_BRARP; Uncharacterized protein
STRINGBra011393.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56822749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-151GATA transcription factor 9