PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009125239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 366aa    MW: 40791.2 Da    PI: 8.8146
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009125239.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.32.7e-23143186144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrC+RtDGKkWRCsr+v++g+k+C+rH+h gr+r+r++k 
  XP_009125239.1 143 DPEPGRCKRTDGKKWRCSRDVVGGHKYCDRHIHPGRNRNRSRKP 186
                     79*******************************99999998875 PP

2QLQ51.72.6e-1877111337
             QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     F+ aQ+q+L+ Q+l+y+y++a++ vP+eLl++i+k
  XP_009125239.1  77 FSLAQWQELELQALIYRYMLAGASVPQELLLPIKK 111
                     9********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.2E-1175111IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.23876111IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.7E-1377109IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.174143189IPR014977WRC domain
PfamPF088794.6E-19144185IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MDLQLKQWRS QQQNESEEQS SATKISNFFL DQIRSQTASS AAAALPLFVP EPTSSTSVSC  60
FSPNTSSSRF LKMGNFFSLA QWQELELQAL IYRYMLAGAS VPQELLLPIK KSLFQSPLNF  120
LHHPQQQNFP HHQPWYWGRG AMDPEPGRCK RTDGKKWRCS RDVVGGHKYC DRHIHPGRNR  180
NRSRKPVETA KPATTTAASS FVLGEDLGHG PNNIFFSSDS SHSSTKHLHL TSHQSCSSGM  240
KQESNKKRPY EAHSGLRSDD GNTLRPFFDD WPRSSDSTSS PMSSSNCHLS ISMPGNTSSD  300
VSLKLSTGDK VEEANNNERE QQQNMNWWSS GGNHHNMGGP LAEALRSASS TSSVLHQMGI  360
SAQVFH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125239.10.0PREDICTED: growth-regulating factor 4-like
SwissprotQ8L8A71e-169GRF4_ARATH; Growth-regulating factor 4
TrEMBLM4EIC60.0M4EIC6_BRARP; Uncharacterized protein
STRINGBra028541.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19262667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-130growth-regulating factor 4