PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009124485.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 889aa    MW: 99068.5 Da    PI: 6.2445
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009124485.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.1e-42134211178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+Ceadls++k+yhrrhkvCe+hska+++lv+g++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  XP_009124485.1 134 VCQVESCEADLSKVKDYHRRHKVCEMHSKATSALVAGIMQRFCQQCSRFHVLEEFDEGKRSCRRRLAGHNKRRRKTNP 211
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.0E-34127196IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.488132209IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.97E-39134213IPR004333Transcription factor, SBP-box
PfamPF031109.3E-31135208IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.4E-7675781IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.71E-7677778IPR020683Ankyrin repeat-containing domain
CDDcd002041.49E-8680778No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 889 aa     Download sequence    Send to blast
MEARVEGEGQ HFYGYRGKRS VEWDLNDWKW DGDLFIATPL NPGVSQTMGR QFFPLGNSSN  60
SSSSCSEEGN GNITREVEKR RRAAAAATGE DTDNNNNNGG LSLKLGENGY DLNGEREGKK  120
TKLGGGSGTN HRSVCQVESC EADLSKVKDY HRRHKVCEMH SKATSALVAG IMQRFCQQCS  180
RFHVLEEFDE GKRSCRRRLA GHNKRRRKTN PEPAANGNPL SDDNQSSNYL LICLLKILSN  240
MHSNGSSDHQ DLMPHLLKSL VSHAGEQLGK NLVELLLQGG SGLLAAPQED SKQAPEIPRQ  300
ELYANGNRSE KLQTKVNDFD LNDIYIDSDD GTDLERSSPP TTTTNPATSS PDYPSWIHQT  360
SRNSDSASDQ SPSSSSEDAQ MRTGRIVFKL FGKEPNDFPP VLRGQILDWL SHTPTDIESY  420
IRPGCIVLTI YLRQAETAWE ELSDDMGFSL SKLLDLSDDP LWTSGWIYVR MQNQYAFVFD  480
GQVVVDTSLP LRSYDHSHII SVRPLAVAAT GKAQFTVKGI NLRRPGTRLL CAVGGKYLIQ  540
ENDDLKESNE CVSFSCDLPI TSGRGFMEIE DQGGLSSSFF PFIVVEEDDV CSEIRILETT  600
LEFTDTDSAK LAMEFIHELG WLLRRSKLGV FSLARFKWLI EFSMDREWCA VIRKLLNMFF  660
EGAVGDSSSD AAALSELCLL HRAVRKNSKP MVEMLLRYVV PNQQRIHSLF RPDAAGPAGL  720
TPLHIAAGKD GSEDVLDALT EDPSMVGIEA WRTSKDTTGF TPEDYARLRG HFSYIHLIQR  780
KINKKSATED HVVVNIPASS ISDREQKETK SGSSALEITH GNNKLQCKLC DHKLVYGTAR  840
RSVAYRPAML SMVAIAAVCV CVALLFKSCP EVLYVFQPFR WELLDYGTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-33125208184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.165000.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBMTransfer from AT2G47070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009124485.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X2
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLM4FIV80.0M4FIV8_BRARP; Uncharacterized protein
STRINGBra041037.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1