PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009123373.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 333aa    MW: 36950.8 Da    PI: 5.4079
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009123373.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573115.92.3e-36107198297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                      fqrlwseeDe++lLqG+idfka+ gksp++d+d+fye ++ksisf++sk q+v+Kir+LK+K+ +k k+   g e s++k+hd ++++l+  iW
  XP_009123373.1 107 SFQRLWSEEDEVSLLQGMIDFKADSGKSPYEDMDRFYELASKSISFEASKIQFVDKIRSLKRKYMGKAKH---GAE-SLTKAHDIDCLKLATCIW 197
                     69****************************************************************9999...655.9***************** PP

          DUF573  97 g 97 
                     g
  XP_009123373.1 198 G 198
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.8E-28108198IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MNTVSFPRNL RMTKKKLTPL EDPPTASSTD DDQVEALSGD DEKEQISDDS SSDHLMNPVA  60
IPPAKRSKSE KPIAVTKPKA VKKRPIETTS ASAKRARIAE EAKKPSSFQR LWSEEDEVSL  120
LQGMIDFKAD SGKSPYEDMD RFYELASKSI SFEASKIQFV DKIRSLKRKY MGKAKHGAES  180
LTKAHDIDCL KLATCIWGLP LDSSAKKLGK EEEQVVAPES ANGDKVEEDR EVLVSGDNGG  240
EDRRVLAGGE KDNEVLINGG GADDWFEDSF LVGSIAGLGV SEQFVKQKWS MVTVETKKRM  300
EDKWKLLQAK EMELVLHKTH FMREIGSVIA EAS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.61790.0flower| root| silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009123373.10.0PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLM4F0950.0M4F095_BRARP; Uncharacterized protein
STRINGBra034488.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-70DNA-binding storekeeper protein-related transcriptional regulator