PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009122224.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 288aa    MW: 32445.2 Da    PI: 6.8919
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009122224.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3103.41.2e-3245153199
                     EEEE-..-HHHHTT-EE--HHH.HTT..........---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh..........ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                     f+k+ltpsdv+k++rlv+pk++ae++          + ++e+++ l++ede g+sW+++++ +++s++yvlt+GW++Fvk+++L+ gD+  F+++
  XP_009122224.1  45 FEKTLTPSDVGKLNRLVIPKQHAEKYfplnaisnnaDASTEKGMLLSFEDELGKSWRFRYSXWNSSQSYVLTQGWSRFVKDKQLDPGDVAFFQRQ 139
                     99********************************9988889****************************************************99 PP

                     SSSEE..EEEEE-S CS
              B3  86 grsefelvvkvfrk 99 
                     +++ ++l+++++r+
  XP_009122224.1 140 RSDPRRLFIGWRRR 153
                     889999******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.0E-3839160IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-2940153IPR015300DNA-binding pseudobarrel domain
CDDcd100177.54E-2644142No hitNo description
SMARTSM010192.0E-2245154IPR003340B3 DNA binding domain
PROSITE profilePS5086313.90245154IPR003340B3 DNA binding domain
PfamPF023625.1E-3045153IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010073Biological Processmeristem maintenance
GO:0010358Biological Processleaf shaping
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSVNHYSTDH HHHHNTLFWQ QLHTTDATET TTATWLNQDQ KESLFEKTLT PSDVGKLNRL  60
VIPKQHAEKY FPLNAISNNA DASTEKGMLL SFEDELGKSW RFRYSXWNSS QSYVLTQGWS  120
RFVKDKQLDP GDVAFFQRQR SDPRRLFIGW RRRGQGSSSA VANPTSYSSS MVAASPYLQV  180
HASSNYSNPP SHSEYSHYGA AVATASETHS IPSSSAVGSS RTVRLFGVNL ECQRDEDDGD  240
DSVAATTATE CPDGYYGQNM YYYYTPHPHN MNIAFTGDTM KQLGDRRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A6e-444216611129DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122224.10.0PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein At5g06250
SwissprotQ9FNI31e-136Y5625_ARATH; B3 domain-containing protein At5g06250
TrEMBLA0A0D3EHF20.0A0A0D3EHF2_BRAOL; Uncharacterized protein
STRINGBra009171.1-P1e-145(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122028100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06250.21e-134B3 family protein