PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009121050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 274aa    MW: 30393.6 Da    PI: 6.7051
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009121050.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.33.6e-152686257
                    T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    r+R+++++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  XP_009121050.1 26 RTRWSPKPEQILILESIFNSgIVNPPKDETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 86
                    89*****************99*************************************997 PP

2Wus_type_Homeobox106.71.4e-342588265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +rtRW+P+peQi iLe++++sG+++P+k+e+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
     XP_009121050.1 25 VRTRWSPKPEQILILESIFNSGIVNPPKDETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRQ 88
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-132292IPR009057Homeodomain-like
PROSITE profilePS5007111.2082287IPR001356Homeobox domain
SMARTSM003893.2E-52491IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-82592IPR009057Homeodomain-like
PfamPF000469.5E-132686IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDQEGSPQSR QGRSPSATTN STEPVRTRWS PKPEQILILE SIFNSGIVNP PKDETVRIRK  60
MLEKFGAVGD ANVFYWFQNR RSRSRRRQRQ LQAANAAAIA TRGVEDPQHM TTMSMHHPYR  120
NNEIDLGFGS CSNSSANYLF NESSSQVSSF LLGLSSSSTN GGCESNNGMG DLFTMYGHES  180
DHHHFHHPQH SSNDASISSP SDQNSSIHYQ QGLMTVFING VPTEVTNGAI DMKAMFGEDL  240
VLLHSSGLPL PTDEFGFLIS LQHGQSYFLV PRQT
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009121050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121050.10.0PREDICTED: WUSCHEL-related homeobox 12
SwissprotQ8GY251e-120WOX12_ARATH; WUSCHEL-related homeobox 12
TrEMBLA0A397XLE10.0A0A397XLE1_BRACM; Uncharacterized protein
STRINGBra002108.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.21e-100WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]