PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009120940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 795aa    MW: 89010.4 Da    PI: 6.9515
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009120940.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.11.8e-36136212177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqv+gCe+d+se+k yhrrh+vC  +++a+ v+++g+ +r+CqqC++fh l +fDe+krsCrr+L++hn+rr++k 
  XP_009120940.1 136 RCQVPGCEVDISELKGYHRRHRVCLRCANASFVVIEGEDKRYCQQCGKFHVLPDFDEGKRSCRRKLERHNNRRKRKP 212
                     6************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-28130198IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.581134211IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-34135215IPR004333Transcription factor, SBP-box
PfamPF031102.7E-27137210IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MSSLSQSQSP SPPEMEIQPP ALLDDDPSAY SSSALWDWGD LLDFAADEPL LVSLDSDQPP  60
FVPPPPLIAT QSDTYHSPDE SGGSGSDRVR KRDPRLLCSN FVEGLLPCSC PELDQKLEEA  120
ELPKKKRVRG GSGVARCQVP GCEVDISELK GYHRRHRVCL RCANASFVVI EGEDKRYCQQ  180
CGKFHVLPDF DEGKRSCRRK LERHNNRRKR KPVDKGGVAS KQQQVLSQND NSVIDVDDGK  240
DNTCSSDQRM EQEASLNFED RHIPTQGSVP FTHSINADNF VSGTGSDEAQ PDEGINDAKF  300
ERSPSGGDNK SAYSTMCPTG RISFKLYDWN PAEFPRRLRH QIFQWLATMP VELEGYIRPG  360
CTILTVFIAM PEIMWAKLSK DPVAYLDEFI LKPGKMLFGR GSMTVYLNNM IFRLIKGGTT  420
LRRVDVKLES PKLQFVYPTC FEAGKPIELV VCGLNLVQPK CRFLVSFSGK YLPHNYSVVP  480
GPGQDGKRSC NNKLYRINIV NSDPNLFGPA FVEVENESGL SNFIPLIVGD KAICSEMKLI  540
EQKFNARLFP EEQDITACCC LTCCCKDFKE RQSTFTGLLL DIAWSVKVPS SECTEQTVNR  600
CQIKRYNRVL NYLIQSNSPS ILGNVLQNLE TLVKKMEPDS FVHCTCDCDV RLLHENMNTA  660
RKQQSHEDSK VNPITSACCC DSSFQDMPSR VLNVNQESEA GLDCTKRIHT ASPDTGRKET  720
DPLLNKEVVM NVNDIGDWPR KSCIPIQSAQ TFRSRQTVLF IATIAVCFAV CAVLYHPNKV  780
TQLAVSIRTR LAHKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A4e-49134219388squamosa promoter binding protein-like 7
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535520.0AK353552.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-52-E05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120940.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X2
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A078DVY30.0A0A078DVY3_BRANA; BnaA10g16180D protein
STRINGBra002188.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7