PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009120441.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 255aa    MW: 28820.9 Da    PI: 9.9506
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009120441.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-181272257
                    T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    ++R+++tkeq++ Le+l+++  r+p a+++++++ +l    +++ ++V++WFqN+ a++++
  XP_009120441.1 12 SPRWNPTKEQITLLENLYKQgIRTPRADQIQQITGRLrahgHIEGKNVFYWFQNHEARQRQ 72
                    58*****************99**************************************96 PP

2Wus_type_Homeobox109.81.6e-351274365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++RW+Pt+eQi++Le+lyk+G+rtP +++iq+it +L+++G+ie+kNVfyWFQN+ aR+rqkq
     XP_009120441.1 12 SPRWNPTKEQITLLENLYKQGIRTPRADQIQQITGRLRAHGHIEGKNVFYWFQNHEARQRQKQ 74
                       78***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-10576IPR009057Homeodomain-like
PROSITE profilePS500719.993873IPR001356Homeobox domain
SMARTSM003894.0E-41077IPR001356Homeobox domain
CDDcd000861.17E-41374No hitNo description
PfamPF000463.9E-161372IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-61372IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MENEGSAGTG SSPRWNPTKE QITLLENLYK QGIRTPRADQ IQQITGRLRA HGHIEGKNVF  60
YWFQNHEARQ RQKQKQDRIA SFNRLLHKTS RFFHPIPCSN VGCVNPYYLH QVRDHHNQHG  120
SVYRQDLHSN KVMLPSGGYE KRTTTDHKKH DSDITTTTAR MSMSSSSFRF DRFALGNHGY  180
FSEGINVNTN GLKTLPLFPL QPLDAANYSG VGNSSFSLRH DSPVTYCGDD GGRGQPFIDF  240
FSSGSSRFNN SGNGL
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the egg cell and the central cell of the embryo sac, but not in the synergids, the antipodals or the male gametophyte. After fertilization, it is expressed in the zygote. After the first division of the zygote, it is detected exclusively in the apical daughter cell, while WOX8 is expressed in the basal daughter cell. Subsequently, it is expressed in all cells of the 4-cell embryo proper and predominantly in the apical domain of the 8-cell embryo. However, in some 8-cell embryos it is also weakly expressed in the central domain suggesting that expression shifts to the most apical cells during this stage. Expression remains restricted to the apical domain in the 16-cell embryo and the early-globular stage. Not expressed in the apical domain thereafter. However, in heart stage embryos it is weakly expressed in a ring of epidermal cells approximately at the junction of hypocotyl and root. Not expressed in mature embryos, endosperm or postembryonically in inflorescences. {ECO:0000269|PubMed:14711878}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009120441.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120441.10.0PREDICTED: WUSCHEL-related homeobox 2
SwissprotQ6X7K11e-133WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A397XLT11e-178A0A397XLT1_BRACM; Uncharacterized protein
STRINGBo9g138280.11e-172(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69142844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-121WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  3. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]