PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009118853.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 334aa    MW: 37140.8 Da    PI: 8.8858
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009118853.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP124.83.6e-39188265178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cq+e+C+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk ++
  XP_009118853.1 188 RCQAERCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKCHQ 265
                     6*************************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.77186263IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.0E-33186250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.32E-37187266IPR004333Transcription factor, SBP-box
PfamPF031105.0E-29189262IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MLDYEWDNTS AIMGSGEERH HHQDLDTTRA LSIFDPTQTN HHQSPYNNFS PPLFSNQQHL  60
TVVYGHQTAH NIPTNQFHHS FYDPNPYASS SSDSIYHAHS SASALFSFDQ SGPAGSGSSY  120
NFLVPKTEVD VVSRSLDFST SNRIGLNLGG RTYFSAGDDD FVSRLYRRSR PGELLGMGNS  180
LSTTLTPRCQ AERCNADLSH AKHYHRRHKV CEFHSKASTV VAAGLSQRFC QQCSRFHLLS  240
EFDNGKRSCR KRLADHNRRR RKCHQSASTS GKHIPDIITT PKSANDSGVK SSSASPSNAP  300
TPISLECFRQ RQFQTTPSSS TSAIWGSLAP AYNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31178262184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118853.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL31e-121SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A078HML50.0A0A078HML5_BRANA; BnaCnng09040D protein
STRINGBra033221.1-P1e-142(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70102743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-113squamosa promoter binding protein-like 8