PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009118813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 323aa    MW: 36126 Da    PI: 6.9061
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009118813.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.5e-33164220258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     +Dgy+WrKYGqK vk+s+fprsYYrCt+a+C+vkk+vers +dp++v++tYeg+H+h
  XP_009118813.1 164 EDGYRWRKYGQKAVKNSPFPRSYYRCTTASCNVKKRVERSFRDPSTVVTTYEGQHTH 220
                     8******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381307.6E-1081323IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.804.3E-34148222IPR003657WRKY domain
SuperFamilySSF1182901.57E-28155221IPR003657WRKY domain
PROSITE profilePS5081130.963158223IPR003657WRKY domain
SMARTSM007741.0E-38163222IPR003657WRKY domain
PfamPF031067.2E-26164220IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MEFTSFYHPS SLSVWEFGDL MAAERDSFEL LGSQDIAAAS PHSFLLETFQ PQTQPFVKLP  60
SADSTIFQAP PSNATTDKSV TSRVESFCSD HFLINSPATP NSSSFSSASS EAVNEEKAKR  120
ENQEEEEQNK SDTNKQVKPK NNSLKRQREP RVAFMTKSEV DHLEDGYRWR KYGQKAVKNS  180
PFPRSYYRCT TASCNVKKRV ERSFRDPSTV VTTYEGQHTH ISPLMSRPVP GGGFFGSSGV  240
ASNLGGNFGF PMESSTLISP QFQQLVHYHQ QQEVLSCFGG VGQYVNSHTH GYGDDERVKK  300
SRGLVRDNGL LQDVVPCHML KEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-28153223777Probable WRKY transcription factor 4
2lex_A9e-28153223777Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009118813.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300410.0KF430041.1 Brassica rapa WRKY transcription factor 23 (WRKY23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288959.10.0probable WRKY transcription factor 23
SwissprotO229001e-144WRK23_ARATH; WRKY transcription factor 23
TrEMBLM4DXZ70.0M4DXZ7_BRARP; WRKY transcription factor
STRINGBra021393.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-117WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]