PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009118548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 211aa    MW: 23988.7 Da    PI: 9.9445
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009118548.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260107.69.9e-3428119192
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                     aCa+Ck +r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++++sl++eA +r++dPv G++g +++ +++l+  k+
  XP_009118548.1  28 ACASCKRQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRPKLTDSLTWEALWRQKDPVLGSYGEYMRQSEELKLYKS 119
                     7********************************************************************************99999988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.50927127IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3128119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MTLLEGDDMM QRNSNNSNIS NNSPPHQACA SCKRQRKKCN NECILSPYFP ARKTKEFQAV  60
HKVFGVSNVQ KMVRTVREED RPKLTDSLTW EALWRQKDPV LGSYGEYMRQ SEELKLYKSL  120
IHNQSLVTWD NNNNQQRVFN NSNNNKNGSA LNSSGSGGFS VVNNNGVGVN REIINGGYTS  180
RNLQGGWGNL KQDQRQQCYA VINGFKHHLP H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118548.11e-158PREDICTED: LOB domain-containing protein 2-like isoform X2
SwissprotQ9LNB91e-106LBD2_ARATH; LOB domain-containing protein 2
TrEMBLM4EUE81e-148M4EUE8_BRARP; Uncharacterized protein
STRINGBra032430.1-P1e-148(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.13e-86LOB domain-containing protein 2