PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009118547.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 212aa    MW: 24202.9 Da    PI: 10.0536
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009118547.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260107.61e-3329120192
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                     aCa+Ck +r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++++sl++eA +r++dPv G++g +++ +++l+  k+
  XP_009118547.1  29 ACASCKRQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRPKLTDSLTWEALWRQKDPVLGSYGEYMRQSEELKLYKS 120
                     7********************************************************************************99999988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.50928128IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3129120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MKERQEGDDM MQRNSNNSNI SNNSPPHQAC ASCKRQRKKC NNECILSPYF PARKTKEFQA  60
VHKVFGVSNV QKMVRTVREE DRPKLTDSLT WEALWRQKDP VLGSYGEYMR QSEELKLYKS  120
LIHNQSLVTW DNNNNQQRVF NNSNNNKNGS ALNSSGSGGF SVVNNNGVGV NREIINGGYT  180
SRNLQGGWGN LKQDQRQQCY AVINGFKHHL PH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-17301061288LOB family transfactor Ramosa2.1
5ly0_B3e-17301061288LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009118547.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118547.11e-158PREDICTED: LOB domain-containing protein 2-like
SwissprotQ9LNB91e-105LBD2_ARATH; LOB domain-containing protein 2
TrEMBLM4EUE81e-147M4EUE8_BRARP; Uncharacterized protein
STRINGBra032430.1-P1e-147(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.13e-86LOB domain-containing protein 2