PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009118406.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 207aa    MW: 23134.3 Da    PI: 4.5969
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009118406.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.44.5e-42321311100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll++lpe++r da++slvyeAear+rdPvyG++g i +lq+q+++l+aela
  XP_009118406.1  32 PCAACKILRRRCGEKCVLAPYFPPTEPAKFSIAHRVFGASNIIKLLQELPESQRIDAVKSLVYEAEARIRDPVYGSTGAIYNLQRQVSELQAELA 126
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     +++ e
  XP_009118406.1 127 KAQVE 131
                     99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.34131132IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4132129IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MPDMESKGDA SAAIIYASPA SSPPPPRVVL SPCAACKILR RRCGEKCVLA PYFPPTEPAK  60
FSIAHRVFGA SNIIKLLQEL PESQRIDAVK SLVYEAEARI RDPVYGSTGA IYNLQRQVSE  120
LQAELAKAQV EIVSMQFQRS NLLELINNMD QPNQDQHKMM AFESSLGNCE HDEFISSSDE  180
ESNDFGFLED KYFNTNSLML WCDPLLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118406.11e-153PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR05e-92LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM4ES211e-153M4ES21_BRARP; Uncharacterized protein
STRINGBra031599.1-P1e-153(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-91LOB domain-containing protein 1