PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009118131.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 303aa    MW: 35207 Da    PI: 6.1282
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009118131.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651e-2071129356
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                     +R+++t+eq+ +Lee++ + +r+p++++++e+A+kl    +++ ++V++WFqN++ +e+
  XP_009118131.1  71 SRWNPTPEQTMVLEEVYSSgTRTPTTQQIQEIASKLqkygRIEGKNVFYWFQNHKSRER 129
                     7*****************99*************************************98 PP

2Wus_type_Homeobox109.61.8e-3570131364
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        ++RW+PtpeQ ++Lee+y+sG+rtP++++iq+i+++L++yG+ie+kNVfyWFQN+k+Rer k
     XP_009118131.1  70 HSRWNPTPEQTMVLEEVYSSGTRTPTTQQIQEIASKLQKYGRIEGKNVFYWFQNHKSRERLK 131
                        68**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.25666131IPR001356Homeobox domain
SuperFamilySSF466891.15E-1267130IPR009057Homeodomain-like
SMARTSM003897.0E-568135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-871129IPR009057Homeodomain-like
PfamPF000463.0E-1871129IPR001356Homeobox domain
CDDcd000861.72E-572129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MPLKKTIRIA LRAQLDNGGK LPPPDGILIN GLSSGATLNI QPGNMNDIRN DEQIITESAG  60
EPKEREKYMH SRWNPTPEQT MVLEEVYSSG TRTPTTQQIQ EIASKLQKYG RIEGKNVFYW  120
FQNHKSRERL KRRRGDQQGV TTISNVHEET LRKDNVIVDT ANKDSSSVSR RRGDHRVIHT  180
RTCLSPSPTH PPKNSIDDGK REEYKRGLEE EKETTSQNQI HPSNTSDFNY HLITASKPSQ  240
EEEQQYKLND DEEEEEETRK SRTLDLFPVI ENQETIDFEE KNTKPNQLYC NYCYYYEFMP  300
LMN
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009118131.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118131.10.0PREDICTED: WUSCHEL-related homeobox 6-like
TrEMBLM4EDD10.0M4EDD1_BRARP; Uncharacterized protein
STRINGBra026791.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.11e-43WOX family protein