PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009117885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BBR-BPC
Protein Properties Length: 287aa    MW: 32027.5 Da    PI: 10.1157
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009117885.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind338.61.6e-10392871301
       GAGA_bind   1 mdddgsrernkgyyepa..aslkenlglqlmssiaerdaki....rernlalsekkaavaerd......maflqrdkalaernkalverdnklla 83 
                     mdddg+  rn+gyyepa  +s+k nlglqlm +i +r++k+    r+ nl ++++ ++++++       m++    +++++       +++k+++
  XP_009117885.1   9 MDDDGF--RNWGYYEPAaaTSFKGNLGLQLMPTI-DRNTKPflpgRDPNL-MIGQTGSYHHQHhhpephMSY----NWINQ-------HKDKFFN 88 
                     99**99..9******99899**************.9**************.999999998888788888888....*****.......789**** PP

       GAGA_bind  84 lllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekk.kkkkrqrakkpkekkakkkkkksekskkk 177
                     +l+++++     p++ +vl++t+s  s+++    +l+      +++++++++p++++++ +++kk k+++++ ++ +k+kk +k+k+++    ++
  XP_009117885.1  89 MLPATTT-----PNYGNVLPQTSSSPSMHM----NLH------HHHHQTDEHPVKCEPDIIETKKrKPNSKAGGAATKAKKPRKPKEENG---DS 165
                     ***8885.....9**************999....332......23455667788887776655540455556677788888888888432...23 PP

       GAGA_bind 178 vkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekL 272
                     ++++   +r+k  kks dlv+ngv++D+s+lPvPvC+CtGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekL
  XP_009117885.1 166 NNANV--SRVKPAKKSFDLVINGVNMDISGLPVPVCTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKL 258
                     33333..689************************************************************************************* PP

       GAGA_bind 273 aaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     a++G++++ p+DLk+hWA+HGtnkfvtir
  XP_009117885.1 259 ASDGFNFGSPIDLKSHWARHGTNKFVTIR 287
                     ****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.8E-1619287IPR010409GAGA-binding transcriptional activator
PfamPF062172.3E-949287IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGPFCIFAMD DDGFRNWGYY EPAAATSFKG NLGLQLMPTI DRNTKPFLPG RDPNLMIGQT  60
GSYHHQHHHP EPHMSYNWIN QHKDKFFNML PATTTPNYGN VLPQTSSSPS MHMNLHHHHH  120
QTDEHPVKCE PDIIETKKRK PNSKAGGAAT KAKKPRKPKE ENGDSNNANV SRVKPAKKSF  180
DLVINGVNMD ISGLPVPVCT CTGAPQQCYR WGCGGWQSAC CTTNISMHPL PMSTKRRGAR  240
ISGRKMSQGA FKKVLEKLAS DGFNFGSPID LKSHWARHGT NKFVTIR
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in pollen grains, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009117885.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013730953.10.0protein BASIC PENTACYSTEINE2-like isoform X1
SwissprotQ9LDE21e-160BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLM4EDF30.0M4EDF3_BRARP; Uncharacterized protein
STRINGBra026813.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28932769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-143basic pentacysteine 2
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]