PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009117339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 393aa    MW: 44641.6 Da    PI: 7.9787
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009117339.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.74.9e-2481125145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++ +++k+CE+H+hrgr+r +ks ++
  XP_009117339.1  81 DPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKSIDQ 125
                     79***************************************9886 PP

2QLQ55.12.4e-191651237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT++ +q+L++Q+l+yKy+++++PvPp+L++ i++
  XP_009117339.1 16 PFTPTXWQELEHQALIYKYMVSGVPVPPDLIFSIRR 51
                    9*******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-111551IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.0221651IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.0E-131650IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.06781125IPR014977WRC domain
PfamPF088791.6E-2082122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MMSLSGSSGR PIGRPPFTPT XWQELEHQAL IYKYMVSGVP VPPDLIFSIR RSLDSFLVSR  60
LLPHQPLGWG CYQMGFGRKQ DPEPGRCRRT DGKKWRCSRE AHPDSKYCEK HMHRGRNRAK  120
KSIDQSQTAA PLTSPSLSFP NNIPSPTLSS STTTTTTTTT TYSASSSSPL AEAYSNSNRF  180
GVGSSNNRGY FNNHSFDYPY PSTPPKQQQQ QQQTLSHVSA LSLHQNTSTP QLNVFASATD  240
HKDFRYFQGI GERVGVGERT FFPEASRSFQ DSPYHHQQPL ATVVDNPYDC TTDHKFDHHH  300
TYSSSSQHHH HDQDHRQQQQ CFVLGADMFN KPTRTILENT SRQDYLNQEE EEKDSSDTKK  360
SLHHFFGEEW TQNKNSSDSW LDLSSQSRLD TGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117339.10.0PREDICTED: LOW QUALITY PROTEIN: growth-regulating factor 5-like
SwissprotQ8L8A61e-180GRF5_ARATH; Growth-regulating factor 5
TrEMBLM4DYC50.0M4DYC5_BRARP; Uncharacterized protein
STRINGBra021521.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45672651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-160growth-regulating factor 5