PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009117215.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 298aa    MW: 34162.9 Da    PI: 7.6959
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009117215.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.7e-32131189159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v++s+fprsYYrCt + C+vkk+vers +d++ v++tYeg+H+h+
  XP_009117215.1 131 LDDGYKWRKYGQKPVRNSPFPRSYYRCTISCCNVKKRVERSFTDQSSVITTYEGQHTHP 189
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-32117191IPR003657WRKY domain
SuperFamilySSF1182901.7E-27124191IPR003657WRKY domain
PROSITE profilePS5081130.159126191IPR003657WRKY domain
SMARTSM007741.9E-35131190IPR003657WRKY domain
PfamPF031061.5E-24132189IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEKTGAGMTF SDLGQRRADP SSLSDSSWER YPVGFMELLG VLHQDSSRYA LTHMPPMQLT  60
ATPNPSSSIS YALCEAVTGE ESNRYYQKLE NDDEEQKHKR NKRFKSTRSS EQTKMKAPRV  120
SFITKSQVNN LDDGYKWRKY GQKPVRNSPF PRSYYRCTIS CCNVKKRVER SFTDQSSVIT  180
TYEGQHTHPR PLILSRQGSF GSDGSASEAY FDLTPTLPPQ LHQLFDYNNH HQQQNQELSP  240
FGTEYLSRQE KEFNHDGGDH YHVIKPRRTQ DLLDGAGLVK DNGLLQDVVP AHIINEEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-241241911077Probable WRKY transcription factor 4
2lex_A3e-241241911077Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009117215.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1728770.0AC172877.1 Brassica rapa subsp. oleifera cultivar Inbred line 'Chiifu' clone KBrH042F19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117215.10.0PREDICTED: probable WRKY transcription factor 68
SwissprotQ93WV62e-98WRK68_ARATH; WRKY transcription factor 68
TrEMBLM4CTY00.0M4CTY0_BRARP; Uncharacterized protein
STRINGBra007674.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150681619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62340.16e-95WRKY family protein