PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009116158.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 324aa    MW: 35885.7 Da    PI: 6.7065
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009116158.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.43.9e-18233266134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     C +C +tkTp+WR gp g+ktLCnaCG++y++ +
  XP_009116158.1 233 CMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGR 266
                     99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.2E-911323IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.728227263IPR000679Zinc finger, GATA-type
SMARTSM004017.2E-16227277IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.4E-14231264IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577165.23E-15231290No hitNo description
CDDcd002022.53E-14232279No hitNo description
PfamPF003204.2E-16233266IPR000679Zinc finger, GATA-type
PROSITE patternPS003440233258IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MFGQSFPEDI DCGNFFDNMD DILDFPGCDM DVGFNIGDSD PFPNIWTNHQ DTWPAASDPL  60
FSSNTNSDSS PELYVPFEDI VKVERPASFV EESLVAKKED SFSTNTDSSS SHSQFRSSSP  120
VSVLESSSSS SQTTNATSLV LSGKHGRPRT KRPRPPVQEM DRVNVCGADS RLIVRIPKQF  180
LSDHSKMITK KKKKKAKVTS SYSSSGIDLE TNGSNNNNNV DSYDSEQHPV RKCMHCEVTK  240
TPQWRLGPMG PKTLCNACGV RYKSGRLFPE YRPANSPTFT PALHSNSHKK VAEMRSKRCS  300
GGSYTNEESN LQDLIPNNAY IGVD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150154KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.7360.0bud| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534610.0AK353461.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-37-G07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009116158.10.0PREDICTED: GATA transcription factor 8
SwissprotQ9SV301e-166GATA8_ARATH; GATA transcription factor 8
TrEMBLM4CSA70.0M4CSA7_BRARP; Uncharacterized protein
STRINGBra007099.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49752751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.21e-148GATA family protein