PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009115989.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 382aa    MW: 42864.1 Da    PI: 7.3008
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009115989.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-24146190145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrC+RtDGKkWRCsr+v++ +k+C+rH+hrgr+rsrk++e+
  XP_009115989.1 146 DPEPGRCKRTDGKKWRCSRDVVASYKYCDRHIHRGRNRSRKPVET 190
                     79****************************************996 PP

2QLQ40.77.4e-1578112337
             QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     F+ aQ+q+L+ Q+l+y+y++a +  P+eLl++i+k
  XP_009115989.1  78 FSLAQWQELELQALIYRYMLACASFPQELLLPIKK 112
                     9********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.9E-776112IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.32977112IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.4E-978110IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.504146190IPR014977WRC domain
PfamPF088797.8E-21147189IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDLQLKQWRS QQQNESEEQG SATKMSSFFF DQIQSQTETS AAALPLFVPE PTSSSSFSCF  60
TPDSSSSSTR HLKMGNFFSL AQWQELELQA LIYRYMLACA SFPQELLLPI KKSLFHQSPL  120
NFLQHPLQHN FPHHQASWYW GRGAMDPEPG RCKRTDGKKW RCSRDVVASY KYCDRHIHRG  180
RNRSRKPVET TAKTATTNAA TNAASSFVLG EELGHGPNNL FFSSGSSHHS SPHLHLNSHQ  240
SCPSDMNQES NNNKRPYETR SGFSNGRSDD GHILRPFFDD WPRSSDSTSS PLTSSTCHLS  300
ISMPGNPPSD VSLKLSTGNE EEEEANMRNN NNNEREQQQN MNWWSSGGNH NNMGGPLAEA  360
LRSASSTSSV LQQMGISTQV FH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115989.10.0PREDICTED: growth-regulating factor 4-like
SwissprotQ8L8A70.0GRF4_ARATH; Growth-regulating factor 4
TrEMBLM4CRW40.0M4CRW4_BRARP; Uncharacterized protein
STRINGBra006956.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19262667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-140growth-regulating factor 4