PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009115210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 273aa    MW: 30915.6 Da    PI: 8.0957
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009115210.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.85.5e-34133190259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCt++ C+vkk+vers +dp++v++tYeg+Hnh+
  XP_009115210.1 133 EDGYRWRKYGQKAVKDSPYPRSYYRCTTQICNVKKRVERSFQDPSIVITTYEGKHNHP 190
                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.7E-35117192IPR003657WRKY domain
SuperFamilySSF1182903.01E-29124192IPR003657WRKY domain
PROSITE profilePS5081132.73127192IPR003657WRKY domain
SMARTSM007742.3E-39132191IPR003657WRKY domain
PfamPF031064.4E-26133190IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MADHKNTSFE ETSFTSLTNC LQSSLVMDYN SLEKVFNNSS PFQPISPSSM GQIANYPYLN  60
LNPYSPIVPS SSNEADPKES LGDKISMEDN EGDQRGVGES SKQLTKQGKG KGEKKEREAR  120
VAFMTKSDID HLEDGYRWRK YGQKAVKDSP YPRSYYRCTT QICNVKKRVE RSFQDPSIVI  180
TTYEGKHNHP IPSSLRGPVV AEHLLGNREN GLLRSFPRHH QEFLMMNHPP VNYQSVGSVP  240
YEHSRLNSSN LREVVGYGLL QDIVPSMLLK HES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-29122193778Probable WRKY transcription factor 4
2lex_A2e-29122193778Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.315654e-32bud
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00168DAPTransfer from AT1G29860Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009115210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115210.10.0PREDICTED: probable WRKY transcription factor 71
SwissprotQ93WV41e-124WRK71_ARATH; WRKY transcription factor 71
TrEMBLA0A3P5Y2B50.0A0A3P5Y2B5_BRACM; Uncharacterized protein
TrEMBLM4EU580.0M4EU58_BRARP; Uncharacterized protein
STRINGBra032340.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139111825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.11e-118WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Guo D, et al.
    The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis.
    Plant Cell, 2015. 27(11): p. 3112-27
    [PMID:26578700]
  2. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. Yu Y, et al.
    WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana.
    Plant Cell Physiol., 2018. 59(2): p. 414-422
    [PMID:29272465]