PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009114434.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 284aa    MW: 32626.1 Da    PI: 5.2807
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009114434.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.73.1e-2166124356
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                     +R+++t+eq+++Lee +++ +r+p++e+++++A+kl    +++ ++V++WFqN++ +e+
  XP_009114434.1  66 SRWNPTPEQITALEEIYKRgTRTPTTEQIQQIASKLskygRIEGKNVFYWFQNHKSRER 124
                     7*****************99*************************************98 PP

2Wus_type_Homeobox112.81.8e-3664126264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        a++RW+PtpeQi+ Lee+yk+G+rtP++e+iq+i+++L++yG+ie+kNVfyWFQN+k+Rer k
     XP_009114434.1  64 ASSRWNPTPEQITALEEIYKRGTRTPTTEQIQQIASKLSKYGRIEGKNVFYWFQNHKSRERLK 126
                        689**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.54861126IPR001356Homeobox domain
SMARTSM003893.6E-663130IPR001356Homeobox domain
SuperFamilySSF466894.71E-1365124IPR009057Homeodomain-like
PfamPF000468.0E-1966124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.0E-966124IPR009057Homeodomain-like
CDDcd000861.31E-667124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0016049Biological Processcell growth
GO:0048314Biological Processembryo sac morphogenesis
GO:0048446Biological Processpetal morphogenesis
GO:0048482Biological Processplant ovule morphogenesis
GO:0051301Biological Processcell division
GO:0048353Cellular Componentprimary endosperm nucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGYISNNNLI NYLAFSTTKP HLLSQFSLNG ILVIVTFDFA GNSIDNDHHQ QLINGSENNS  60
AAAASSRWNP TPEQITALEE IYKRGTRTPT TEQIQQIASK LSKYGRIEGK NVFYWFQNHK  120
SRERLKRRRC EGDNDINSVH EPLKDVKDSS SGGYRVDQTK IYASFPHTNQ RPQNELVLPN  180
LINNEDHCKT EESERASDAG KEAMCGNLVA SFVNQEPGEI NIEEDRYNVR GEVQEEEEED  240
ETREIQTLNL FPVLENQEKT DWFAEKKKAN VLEYHMRLFG AQKR
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In developing seeds, it is expressed in the embryo, suspensor and endosperm nuclei, but absent in the integuments. In seedlings, it is expressed in the shoot apical meristem and leaf primordia, but not in expanded cotyledons or mature leaves. In reproductive structures, transcripts could be detected in floral apical meristems, floral primordia, stamens and pistils. Also expressed in the tapetum in anthers and in the gynoecium. Weakly expressed in petals, sepals and the walls of carpels. {ECO:0000269|PubMed:15659481}.
UniprotTISSUE SPECIFICITY: Highly expressed in developing ovules. Present in developing primordia and differentiating organs but absent in mature organs. {ECO:0000269|PubMed:15659481}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that plays a central role in ovule patterning by regulating cell proliferation of the maternal integuments and differentiation of the maegaspore mother cell (MCC). Involved in AGAMOUS (AG) repression in leaves. {ECO:0000269|PubMed:15659481}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009114434.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018509872.10.0PREDICTED: WUSCHEL-related homeobox 6
SwissprotQ9ZVF51e-85WOX6_ARATH; WUSCHEL-related homeobox 6
TrEMBLA0A3P5YHF01e-175A0A3P5YHF0_BRACM; Uncharacterized protein
TrEMBLM4DLR71e-175M4DLR7_BRARP; Uncharacterized protein
STRINGBra017448.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.11e-74WOX family protein