PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009113771.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 365aa    MW: 40783.6 Da    PI: 8.872
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009113771.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.87.2e-39163239177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqv+gC+ dls+ak+yhr+h+vCe+hsk+p+v+vsg+e+rfCqqCsr h++sefDe+krsCr rL++hn+rrrk+q
  XP_009113771.1 163 RCQVDGCDLDLSSAKDYHRKHRVCETHSKCPKVTVSGVERRFCQQCSRLHAVSEFDEKKRSCRIRLSHHNARRRKSQ 239
                     6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-32155225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.265161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.49E-36162239IPR004333Transcription factor, SBP-box
PfamPF031103.4E-30164237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDCNMRSPLL WDWENLIISN PSNDKKQLTN TTSEWEIEKG EGIESLFPCL DGLQRVSNDS  60
TTSFWHTTSV SKSSQSTSTN SSSPIIKQTK LASENSPGDS CSNIDFVQVK TSTAVESDLC  120
LKLGKRTYSG RDVSPVSTKL LPPCVVTRKK SKFCGQSSMQ VPRCQVDGCD LDLSSAKDYH  180
RKHRVCETHS KCPKVTVSGV ERRFCQQCSR LHAVSEFDEK KRSCRIRLSH HNARRRKSQG  240
VFPFNPERVY DQRQHTNVVW GTTCDTKPTQ RESGFTLSFQ RGNGSKEEQL FASSNHSLSA  300
YQTSGGFSAG KNKFQLGVGE YSEVLHQSQD FHRAFSLLST SSGPLVHPHA QQPLSLLFSF  360
DGVPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-25155237484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1219236KKRSCRIRLSHHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.256430.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896490.0AC189649.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS010I09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009113770.10.0PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_009113771.10.0PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_009113772.10.0PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_009113774.10.0PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_009113775.10.0PREDICTED: squamosa promoter-binding-like protein 11
SwissprotQ9FZK01e-169SPL11_ARATH; Squamosa promoter-binding-like protein 11
TrEMBLM4EVI90.0M4EVI9_BRARP; Uncharacterized protein
STRINGBra032822.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.41e-165squamosa promoter-like 11