PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009112294.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 330aa    MW: 36564.5 Da    PI: 6.5849
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009112294.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.15.7e-19242276135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  XP_009112294.1 242 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRL 276
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.5E-995330IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.991236272IPR000679Zinc finger, GATA-type
SMARTSM004011.9E-15236290IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-14238298No hitNo description
Gene3DG3DSA:3.30.50.101.3E-14240274IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.93E-15241289No hitNo description
PfamPF003208.0E-17242276IPR000679Zinc finger, GATA-type
PROSITE patternPS003440242267IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MERVEAALKS SVRKDMAFKT TLPVYEDFLA VTTAEDFSVD DFFDLSNDSV FTEEEAEPKT  60
HQEMLHVSSQ EPHDKGDALR LNNDGFGSLP PSELSVPTDE LAELEWLSHF VEDSFTEYSA  120
PNLTGTPTEK PAWLTGDRKH PVTPVTHDSC FKSPVPSKSR TKRNRNGTNF WSLGSSSSSG  180
PSSSNSTSSS SSDPSNTWFS GAELLEPVFT SEKPPVPKKH KKRSAESVYS GQLVLQQPSR  240
RCSHCGVQKT PQWRAGPLGA KTLCNACGVR FKSGRLLPEY RPACSPTFSS ELHSNHHRKV  300
MEMRRKKEPT DDNETGLNQL VQSPQAVPSY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.113520.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892250.0AC189225.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB011P07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112294.10.0PREDICTED: GATA transcription factor 5
RefseqXP_009112295.10.0PREDICTED: GATA transcription factor 5
RefseqXP_009112296.10.0PREDICTED: GATA transcription factor 5
RefseqXP_009112297.10.0PREDICTED: GATA transcription factor 5
SwissprotQ9FH571e-172GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A078FW200.0A0A078FW20_BRANA; BnaA09g07950D protein
TrEMBLM4F7W20.0M4F7W2_BRARP; Uncharacterized protein
STRINGBra037173.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36982561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-166GATA transcription factor 5