PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009112159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 206aa    MW: 23463 Da    PI: 6.3929
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009112159.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY871.6e-27113171159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +dDgy+WrKYG+K+vk++ + r+YY+C+s+gC+vkk++er+ +d  +v++tYeg Hnhe
  XP_009112159.1 113 MDDGYKWRKYGKKSVKNNINKRNYYKCSSEGCMVKKRIERDGKDAAYVITTYEGVHNHE 171
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.2E-30100173IPR003657WRKY domain
SuperFamilySSF1182904.71E-26105173IPR003657WRKY domain
PROSITE profilePS5081129.046108173IPR003657WRKY domain
SMARTSM007743.0E-30113172IPR003657WRKY domain
PfamPF031061.8E-21114171IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MNFPQNPNPN FTFLSDENFI SPFMDNFDFT NLMFEVDEGG NNGLVQEENS PPTSIVSSET  60
LTCDSSGSGS AVMTLSKKDS TFDCINRGIK DAETKEPPSH RVAFRTRSKM DVMDDGYKWR  120
KYGKKSVKNN INKRNYYKCS SEGCMVKKRI ERDGKDAAYV ITTYEGVHNH EIPSHVYYSD  180
MVSSYDHNNW NQHSLLQSIQ HISPPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-23103174778Probable WRKY transcription factor 4
2lex_A1e-23103174778Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.288290.0leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009112159.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112159.11e-155PREDICTED: probable WRKY transcription factor 51 isoform X1
SwissprotQ93WU91e-106WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLA0A3P5Y8U11e-153A0A3P5Y8U1_BRACM; Uncharacterized protein
STRINGBo9g018440.11e-124(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57112747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-99WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Yan C, et al.
    Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis.
    Mol. Cell, 2018. 70(1): p. 136-149.e7
    [PMID:29625034]