PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009112044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 340aa    MW: 36648.6 Da    PI: 8.0048
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009112044.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.8e-3970129362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  XP_009112044.1  70 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 129
                     6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3460123IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3271127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.76173127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGLTSLQACM DSDWLQEAES SGGSMLDSTT TSPSAADILA ACSTRPQASA MVVAAAAMMD  60
GGRRLRPPHD HPQKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVGG  120
GCRKNKKPSS SNSPSSKKPN IVTSDLMALA HSHQNYQNAS LGFQHFGGNG MMGSYTAPDH  180
SNVGYLESKY GGLLSQSPRP IDFLDSKFDL MGVNNNNLVM VDHGSNGDHH HNLHNNIGGG  240
GLMDISACQR LMLSNYDHHH YNHHEDNQRV TSIMDVKPSP KLLSLDWQQE QGFSEGSGNG  300
GGGRSDGGGY AGGGYINGLG SSWNGLMNGY GSSTKTNSLV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1301308GGRSDGGG
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the vascular tissues and pericycle of primary roots. Detected in the vasculature of the cotyledons, rosette leaves and cauline leaves. In flowers, localized in vasculature of petals, stigma, and stamen filaments, and, to a lower extent, in anthers and carpels. In inflorescence stems, accumulates in the vasculature, particularly in cambium, phloem, and interfascicular parenchyma cells. {ECO:0000269|PubMed:19915089}.
UniprotTISSUE SPECIFICITY: The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). Preferentially expressed in the vasculature of all organs, including seedlings, roots, stems, buds, leaves, flowers and siliques, and particularly in the cambium, phloem and interfascicular parenchyma cells of inflorescence stems (PubMed:19915089). {ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009112044.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2289921e-161AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12.
GenBankBT0204671e-161BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankBT0205761e-161BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112044.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM031e-165DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLM4F4730.0M4F473_BRARP; Uncharacterized protein
STRINGBra035873.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-144Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]