PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009110996.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 198aa    MW: 22607.2 Da    PI: 10.093
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009110996.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.71e-3421112192
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                     aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g +++++++l+  k+
  XP_009110996.1  21 ACASCKHQRKKCNNECILSPYFPARKNKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSESLTWEALWRQKDPVLGSYGEYRRISEELKVYKS 112
                     7***********************************************************************************99988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.86720120IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-3221111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MMQRNSNNNN NISNNPSSHQ ACASCKHQRK KCNNECILSP YFPARKNKEF QAVHKVFGVS  60
NVQKMVRTVR EEDRTKLSES LTWEALWRQK DPVLGSYGEY RRISEELKVY KSLVHNQPLI  120
GWDNNQRVLN NNNKNGLAVN SSGSGGFTVN NNGVGVNRDV INGGYLSRSG YENLRQDQRQ  180
QCYAVINGFK QHYLPLSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-181398388LOB family transfactor Ramosa2.1
5ly0_B1e-181398388LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.210190.0bud| flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009110996.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110996.11e-145PREDICTED: LOB domain-containing protein 2
SwissprotQ9LNB91e-111LBD2_ARATH; LOB domain-containing protein 2
TrEMBLM4EPC71e-143M4EPC7_BRARP; Uncharacterized protein
STRINGBra030647.1-P1e-143(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.16e-85LOB domain-containing protein 2