PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009110565.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 465aa    MW: 50298.9 Da    PI: 8.6593
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009110565.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.53.3e-34210266259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      DgynWrKYGqK+vkgsefprsYY+Cts+gCpvkkkvers  d++v+ei+Y+g+Hnhe
  XP_009110565.1 210 VDGYNWRKYGQKQVKGSEFPRSYYKCTSPGCPVKKKVERSL-DGQVTEIIYKGQHNHE 266
                     59***************************************.***************8 PP

2WRKY104.84.6e-33363421159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vkg+++prsYY+Ct++gC v+k+ver+a+dpk+v++tYeg+Hnh+
  XP_009110565.1 363 LDDGYRWRKYGQKIVKGNPYPRSYYKCTTQGCGVRKHVERAATDPKAVVTTYEGKHNHD 421
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-29204268IPR003657WRKY domain
SMARTSM007741.6E-37209267IPR003657WRKY domain
SuperFamilySSF1182901.31E-25209268IPR003657WRKY domain
PROSITE profilePS5081124.719211268IPR003657WRKY domain
PfamPF031064.3E-26211266IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-36349423IPR003657WRKY domain
SuperFamilySSF1182901.57E-29355423IPR003657WRKY domain
PROSITE profilePS5081137.952358423IPR003657WRKY domain
SMARTSM007749.5E-39363422IPR003657WRKY domain
PfamPF031064.3E-26364421IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MSEKAELPST SNSTGAPSRP TLSLLPRPFT ETFFNGGVGF SPGPMTLVSN MFSDSDESSR  60
SFSQLLAGVV MPSPATGSEG NSNSSSSSVD VVDPRFKQSR PTGLMVSQSP SVFTVPPGLS  120
PAMLLDSPSF LGLISPLQGS YGMTHQQALA QVTTQAVQAN ANMQPPSSQV RSQNPTSAPD  180
SSLLAQRETS DITIMEHRSQ QPLNVDKPAV DGYNWRKYGQ KQVKGSEFPR SYYKCTSPGC  240
PVKKKVERSL DGQVTEIIYK GQHNHEPPQN TKRGNKDSLH GSLINNNPNK TTREQHEAAS  300
QATTEQMSEA SDSEEVGNGD TGVRDEPDAK RRVLEPAAAV AASHRTVAEP RIIVQTTSEV  360
DLLDDGYRWR KYGQKIVKGN PYPRSYYKCT TQGCGVRKHV ERAATDPKAV VTTYEGKHNH  420
DPPAAKSSSH AAAAAAQLRH GGLANLNQQQ QQPVACLRLK EEQTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-44211424878Probable WRKY transcription factor 4
2lex_A8e-44211424878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009110565.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931590.0KM593159.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY87) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110565.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI900.0WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLM4DJN80.0M4DJN8_BRARP; Uncharacterized protein
STRINGBra016716.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.10.0WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]