PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009110523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BBR-BPC
Protein Properties Length: 273aa    MW: 30534.6 Da    PI: 10.0127
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009110523.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind342.88.3e-10512731301
       GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd....maflqrdkalaernkalverdnkllalll 86 
                     mdddg+  rn+gyyepa a++k nlglqlmss  +r++k+    r+ nl ++++++++++ +    m++    +++++       +++k++++l+
  XP_009110523.1   1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSSA-DRNTKPflpgRDPNL-MIGQNGSYHHAEppihMSY----NWINQ-------QKDKFFNMLP 80 
                     99**99..9*******999*************9.9**************.************5555555....*****.......899******* PP

       GAGA_bind  87 venslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkke 181
                     v+++     p++ +vl++t+s+ s+++++++q+e+++v+ +eee     +i++ +++ k+++     + ++++k kk +k+k+     ++++k++
  XP_009110523.1  81 VTTT-----PNYGNVLPETSSAPSMHHHHHHQTEENPVKCEEEE-----EIVQPNKKRKTNS-----KASATAKGKKPRKPKE-----ENDSKTN 155
                     9986.....9****************************965555.....4444322222222.....3445666677777777.....2344455 PP

       GAGA_bind 182 saderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeG 276
                        +r+k  kks+dlv+ngv++D+s+lPvPvC+CtGa++qCY+WG+G WqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekL+++G
  XP_009110523.1 156 V--SRVKPAKKSVDLVINGVNMDISGLPVPVCTCTGAPQQCYRWGCGSWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLSSDG 248
                     5..689***************************************************************************************** PP

       GAGA_bind 277 ydlsnpvDLkdhWAkHGtnkfvtir 301
                     ++++ p+DLk+hWA+HGtnkfvtir
  XP_009110523.1 249 FNFGSPIDLKSHWARHGTNKFVTIR 273
                     ************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.4E-1631273IPR010409GAGA-binding transcriptional activator
PfamPF062171.6E-951273IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GNLGLQLMSS ADRNTKPFLP GRDPNLMIGQ NGSYHHAEPP  60
IHMSYNWINQ QKDKFFNMLP VTTTPNYGNV LPETSSAPSM HHHHHHQTEE NPVKCEEEEE  120
IVQPNKKRKT NSKASATAKG KKPRKPKEEN DSKTNVSRVK PAKKSVDLVI NGVNMDISGL  180
PVPVCTCTGA PQQCYRWGCG SWQSACCTTN ISMHPLPMST KRRGARISGR KMSQGAFKKV  240
LEKLSSDGFN FGSPIDLKSH WARHGTNKFV TIR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.134200.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in pollen grains, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009110523.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110521.10.0PREDICTED: protein BASIC PENTACYSTEINE2 isoform X1
SwissprotQ9LDE21e-170BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLM4DJK80.0M4DJK8_BRARP; Uncharacterized protein
STRINGBra016686.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-162basic pentacysteine 2
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]