PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009110322.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 377aa    MW: 43314.6 Da    PI: 6.5891
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009110322.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.86e-23953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr e++ nrqvt+skR+ gilKKA+ELS+LCd+++ +++fs+tgk
  XP_009110322.1  9 KRLESTGNRQVTYSKRKSGILKKAKELSILCDIDIVLLMFSPTGK 53
                    6889****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-31160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.838161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-27295IPR002100Transcription factor, MADS-box
CDDcd002663.94E-28282No hitNo description
PRINTSPR004046.7E-19323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-201257IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRVKLKIKR LESTGNRQVT YSKRKSGILK KAKELSILCD IDIVLLMFSP TGKPTVFHGE  60
HSCIEEVISK FAQLTPQERT KRKLESLEAL KKTFKKLDHD VNIHEFLGAR NQTIEGLSNQ  120
VAISQAQLME CHRRLSCWTN IDRIENTEHL NLLEESLRKS IERIQFHKEH YAKNQLLPLD  180
CTTTQFHSGI QLPLAMEGNN SMQEAHSMSW LPNNDNQETI LPGESSFLPH REMDGLNPVY  240
SNGFFESVKQ EDQMCSNQGQ QFEQLEQQQG HGCLGLQQIG EEFSYPTPFG TTLGMDEDQE  300
KKIKSEMELN NLQQKQQQQD PSSMYAPTAN NGGCFQNPHD QSMFSTDHHH HYQHYQHHQN  360
WVPGPVFGQA SYNQQPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-13192190Myocyte-specific enhancer factor 2B
1tqe_Q1e-13192190Myocyte-specific enhancer factor 2B
1tqe_R1e-13192190Myocyte-specific enhancer factor 2B
1tqe_S1e-13192190Myocyte-specific enhancer factor 2B
5f28_A1e-13196194MEF2C
5f28_B1e-13196194MEF2C
5f28_C1e-13196194MEF2C
5f28_D1e-13196194MEF2C
6byy_A1e-13192190MEF2 CHIMERA
6byy_B1e-13192190MEF2 CHIMERA
6byy_C1e-13192190MEF2 CHIMERA
6byy_D1e-13192190MEF2 CHIMERA
6c9l_A1e-13192190Myocyte-specific enhancer factor 2B
6c9l_B1e-13192190Myocyte-specific enhancer factor 2B
6c9l_C1e-13192190Myocyte-specific enhancer factor 2B
6c9l_D1e-13192190Myocyte-specific enhancer factor 2B
6c9l_E1e-13192190Myocyte-specific enhancer factor 2B
6c9l_F1e-13192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009110322.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1431720.0AY143172.1 Arabidopsis thaliana MADS-box protein AGL65 (AGL65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018508940.10.0PREDICTED: agamous-like MADS-box protein AGL65
RefseqXP_022546511.10.0agamous-like MADS-box protein AGL65
SwissprotQ7X9I00.0AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A3P6C9C00.0A0A3P6C9C0_BRACM; Uncharacterized protein
STRINGBo8g068060.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.10.0AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]