PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009110185.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 273aa    MW: 30917.6 Da    PI: 5.5064
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009110185.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA572.7e-18177210134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+Cgt +Tp+WR gp g+ktLCnaCG+++++ +
  XP_009110185.1 177 CSHCGTNTTPQWRTGPVGPKTLCNACGVRFKSGR 210
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.3E-797267IPR016679Transcription factor, GATA, plant
SMARTSM004011.3E-14171221IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-14174234No hitNo description
Gene3DG3DSA:3.30.50.106.5E-14175208IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.123175207IPR000679Zinc finger, GATA-type
CDDcd002021.23E-15176233No hitNo description
PfamPF003206.1E-16177211IPR000679Zinc finger, GATA-type
PROSITE patternPS003440177202IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MELWTEARAL KASLRGEAIK HQVIVSEELS RTSSAEDFSV ECFLDFSEVQ EEEEELVSIS  60
SSQEEQEQDC CNNSSQPCIF DQLPSLPDGD VEELEWVSRV VDDCSSQEVS LLFTQTLKTK  120
PNFSSRVPVK PRTKRPRNSL TGDRVWPLVS TNQHAAGEQQ WRKKKKQEPV IVFQRRCSHC  180
GTNTTPQWRT GPVGPKTLCN ACGVRFKSGR LCPEYRPADS PTFSNEIHSN LHRKVLELRK  240
SKELVEEETG EAITKTDQVK FGSQSGREDL GKM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.269920.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895290.0AC189529.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB092P05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013648485.10.0PREDICTED: GATA transcription factor 3-like
RefseqXP_013648406.10.0PREDICTED: GATA transcription factor 3-like
RefseqXP_009110185.10.0PREDICTED: GATA transcription factor 3
RefseqXP_009110121.10.0PREDICTED: GATA transcription factor 3
RefseqXP_009110050.10.0PREDICTED: GATA transcription factor 3
RefseqXP_009110008.10.0PREDICTED: GATA transcription factor 3
SwissprotQ8L4M61e-139GATA3_ARATH; GATA transcription factor 3
TrEMBLA0A078CH840.0A0A078CH84_BRANA; BnaA01g02480D protein
TrEMBLM4D4Z50.0M4D4Z5_BRARP; Uncharacterized protein
STRINGBra011552.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.21e-127GATA transcription factor 3