PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009109967.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 236aa    MW: 26906.9 Da    PI: 4.9152
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009109967.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85e-2073133257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     r+R+t+t+ ql++Le+lF + + +ps++++++L+++l    ++ e+++ +WFqNrRa+ k+
  XP_009109967.1  73 RQRWTPTPMQLQILERLFDQdTGTPSKQKIKDLTEELsqhgQIAEQNICNWFQNRRARSKR 133
                     89*****************99**************************************97 PP

2Wus_type_Homeobox92.73.3e-3072135265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+l+++ + tP+k++i+++t+eL+++G+i ++N+ +WFQNr+aR+++kq
     XP_009109967.1  72 ARQRWTPTPMQLQILERLFDQDTGTPSKQKIKDLTEELSQHGQIAEQNICNWFQNRRARSKRKQ 135
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-1569136IPR009057Homeodomain-like
PROSITE profilePS5007114.72269134IPR001356Homeobox domain
SMARTSM003893.6E-1471138IPR001356Homeobox domain
SuperFamilySSF466891.07E-1672136IPR009057Homeodomain-like
PfamPF000468.3E-1873133IPR001356Homeobox domain
CDDcd000861.20E-1173135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MMELDNQQQP NPMKVMTDEQ LETLRKQIAI YATICERLVE MHKTLTSQQD LAAGGRMGGL  60
YTDTSICQKM TARQRWTPTP MQLQILERLF DQDTGTPSKQ KIKDLTEELS QHGQIAEQNI  120
CNWFQNRRAR SKRKQHCGVG SSNNKNGEGE VETETETLNE KRKRPESLLV QTDGNNNNND  180
IGTATATSPR PEDLCFQSPE MSSDLHLLGV QSNTRDEHLV ESYNLYDHVE DYDMSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009109967.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895410.0AC189541.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH004A18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109967.11e-178PREDICTED: WUSCHEL-related homeobox 13-like
RefseqXP_013654249.21e-178WUSCHEL-related homeobox 13-like
SwissprotO817881e-116WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A397YBX71e-177A0A397YBX7_BRACM; Uncharacterized protein
TrEMBLM4D2311e-177M4D231_BRARP; Uncharacterized protein
STRINGBra010531.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-108WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]