PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009109815.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 366aa    MW: 41013.3 Da    PI: 6.441
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009109815.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.11.2e-38151225175
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                     +Cq++gCe dls+ak+yhr+h+vC+ hsk+p+v+v gle+rfCqqCsr h++sefDe+krsCr+rL +hn+rrrk
  XP_009109815.1 151 RCQIDGCELDLSSAKDYHRKHRVCDNHSKCPKVTVGGLERRFCQQCSRLHAVSEFDEKKRSCRKRLTHHNARRRK 225
                     6*************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-31144213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.052149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.23E-36150226IPR004333Transcription factor, SBP-box
PfamPF031102.3E-29152225IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MDCNMASPTW DWDHLIMSNP SKTENDENQQ PSAEWEIEKG EGIESMLFPC FDGLEKVSSG  60
SPSGFWHSQS TSTNSSSPKV KQTNLASESS PGDSCSNVDS VQVKASTAAE SDLCLELGKQ  120
TYSEEFWCRD NNDLQAVSMN ARKKQSVQVP RCQIDGCELD LSSAKDYHRK HRVCDNHSKC  180
PKVTVGGLER RFCQQCSRLH AVSEFDEKKR SCRKRLTHHN ARRRKLPGMF PLNPERVCNP  240
RQHTNMLWNE LSLNTESEET FAWDTTYDTK PTQIESGFTL SFQRGHGRPD EQVVAGSSRS  300
FSPYQTSGGF QLPSKGVGEY SGGLNESQDF YSALSLLSTS SDSRGTKHNP MVESQPIHGT  360
FPTHFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-241522251184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207224KKRSCRKRLTHHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109814.10.0PREDICTED: squamosa promoter-binding-like protein 10 isoform X1
RefseqXP_009109815.10.0PREDICTED: squamosa promoter-binding-like protein 10 isoform X1
SwissprotQ8S9L01e-176SPL10_ARATH; Squamosa promoter-binding-like protein 10
TrEMBLM4D3950.0M4D395_BRARP; Uncharacterized protein
STRINGBra010949.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-168squamosa promoter binding protein-like 10