PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009109173.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 534aa    MW: 58692.3 Da    PI: 7.0156
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009109173.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY986.2e-31207264260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  e+s+ d+++++i+Y+g+H+h+k
  XP_009109173.1 207 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFETSH-DGRITDIIYKGTHDHPK 264
                     8***************************************9.***************85 PP

2WRKY107.27.9e-34364422159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct +gCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_009109173.1 364 LDDGYRWRKYGQKVVRGNPNPRSYYKCTAPGCPVRKHVERASHDPKAVITTYEGKHNHD 422
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.905201265IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-26204265IPR003657WRKY domain
SuperFamilySSF1182902.48E-24204265IPR003657WRKY domain
SMARTSM007747.3E-33206264IPR003657WRKY domain
PfamPF031061.6E-23207263IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-37349424IPR003657WRKY domain
SuperFamilySSF1182901.57E-29356424IPR003657WRKY domain
PROSITE profilePS5081138.629359424IPR003657WRKY domain
SMARTSM007743.1E-39364423IPR003657WRKY domain
PfamPF031064.2E-26365422IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MDPPQANIDR EELQVDCSAT VDPTARHNSA GGGGGARYKL MSPAMLPISR STTNITIPPG  60
LSPTSFLESP VFISNIKPEP SPTTGSLFKP RPVHVSSSSY TGRAFHQNTF TEHNSSEFEF  120
RPPASNMVYS ELDKHKREPP VQFQDQGHGS SHSPEAAASS SEPSRPTPPV QTPPTSSDIP  180
AGSDQEESVQ TSQNESRGSA PPTVLADDGY NWRKYGQKHV KGSEFPRSYY KCTHPNCEVK  240
KLFETSHDGR ITDIIYKGTH DHPKPQPGRR NSGGVGMAAQ EERVEKGVYS LSQAIEQTGN  300
PEVASTNNDG GDVAASNRNK DDPEDDDPYT KRRRLDGNME ITPLVKPIRE PRVVVQTLSE  360
VDILDDGYRW RKYGQKVVRG NPNPRSYYKC TAPGCPVRKH VERASHDPKA VITTYEGKHN  420
HDVPTSKSGS SNHHEIQPRF RPPDETDTIS LNLGVGISSN GPNENQQLVN QTHPNGVGFR  480
FVHAAPVSTY YASMNQYGPR ETQSETQNGD ISSLNHSSSY PYPHNNIGRI QTGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-38205424877Probable WRKY transcription factor 4
2lex_A7e-38205424877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1330334KRRRL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009109173.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9123930.0EU912393.1 Brassica napus WRKY20-1 transcription factor (WRKY20-1) mRNA, complete cds.
GenBankKC2465700.0KC246570.1 Brassica napus WRKY transcription factor 20.1 (WRKY20.1) mRNA, complete cds.
GenBankKC2465710.0KC246571.1 Brassica napus WRKY transcription factor 20.2 (WRKY20.2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109173.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM4D1T10.0M4D1T1_BRARP; Uncharacterized protein
STRINGBra010431.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein