PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009109067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 574aa    MW: 61445.4 Da    PI: 7.742
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009109067.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.92.3e-14120159141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk s+Clk+YCeCfaag++C+  C+C +C+N+ +
  XP_009109067.1 120 QKKKHCNCKLSRCLKLYCECFAAGTYCDG-CNCLNCFNNVD 159
                     589**************************.********986 PP

2TCR51.32.3e-16202241140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a++ Cse+C+C +CkN e
  XP_009109067.1 202 KHNKGCHCKKSGCLKKYCECFQANVLCSENCRCLGCKNFE 241
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.7E-16120160IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.518121242IPR005172CRC domain
PfamPF036381.1E-10122157IPR005172CRC domain
SMARTSM011143.8E-19202243IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12205240IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MGEGGGGGGG GGDFPPKKDG VSDESCFQAK KEATQLDFTG GSDEHYSESH TVVPPSVTPP  60
VTTTPSRLHP VARPALPVVT SQSQSQSQIL NAPISLPKPP ESPESRARPP IVEGRDGTPQ  120
KKKHCNCKLS RCLKLYCECF AAGTYCDGCN CLNCFNNVDN EPARRDAVEA TLDRNPNAFR  180
PKIASSPHGV RDKKEEIVLL GKHNKGCHCK KSGCLKKYCE CFQANVLCSE NCRCLGCKNF  240
EGSEERQALF HGEHANNMAY LQQAANAAIT GAVGSSGFAP FPAPKRRKGQ DISFNQATND  300
SSMHRLGQFQ QASNGRTSGP TSTTSPANVS RAGGNSSAPS KFVYRSLLAE IIQPQDVKAL  360
CSVLVAVAGE TTKTLTDRRN ETEKRVEDQT ETSLASYNSQ GNKTDGSQAD GSKGDPLSPA  420
TLALMCDEQD SLFMVAAAEP NGSVDPGGCG TNSQGQSEIY AEKERVVLTK FRDCLTRLIS  480
YADFKESKCS YLARSHIQSP STVPTVTVKT ENGIQQRPPV VNGASLTTTQ PALNKPQLVQ  540
PTTTTDTSSS HHPHKPPALE ENKDTSESNK VYST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-3212225111132Protein lin-54 homolog
5fd3_B3e-3212225111132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009109067.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109067.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLM4D1J80.0M4D1J8_BRARP; Uncharacterized protein
STRINGBra010348.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein