PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009108959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 454aa    MW: 49221.8 Da    PI: 6.9279
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009108959.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.85.9e-25162218259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+++g+H he
  XP_009108959.1 162 HDGYHWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECSNDSGNVIEIVNKGSHSHE 218
                     7********************************98.*********************8 PP

2WRKY98.63.9e-31319375359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e+s e++++v+itY+g Hnh+
  XP_009108959.1 319 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETSGENKTAVVITYKGVHNHD 375
                     9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-19158219IPR003657WRKY domain
SuperFamilySSF1182902.62E-19159218IPR003657WRKY domain
SMARTSM007747.3E-23161219IPR003657WRKY domain
PfamPF031068.6E-17163217IPR003657WRKY domain
PROSITE profilePS5081115.078163220IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-31303377IPR003657WRKY domain
PROSITE profilePS5081132.248312377IPR003657WRKY domain
SuperFamilySSF1182905.23E-27313377IPR003657WRKY domain
SMARTSM007744.9E-35317376IPR003657WRKY domain
PfamPF031061.6E-23319375IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MDDKDSGEAD VYAAAETEKG EKVEPEKELC HGDDDGLSQL RGEESPVRET LAKDHDEDVR  60
ENSSVEPNRE DVKERDSGSG KESVVSAIGP VDEVAVENRV VEPSACMTVL INPSMVEASL  120
SSNPSAAHGV SLVSVPSKQE QRSDSRVVSN LSVSPVLRTP AHDGYHWRKY GQKQVKSPKG  180
SRSYYRCTYS DCCAKKIECS NDSGNVIEIV NKGSHSHEPL RKNSFSPRET RAASVIPPME  240
DNTVVPTGSA LSISTKENVC QSLAIVEGKR NCENEAVEEP EPKRRLKKSN SQSSDSVSKP  300
GKKYKVVVHA AGDVGISGDG YRWRKYGQKM VKGNPNPRNY YRCTSAGCPV RKHIETSGEN  360
KTAVVITYKG VHNHDMPVPK KRHGPPSSAL VAAAAPTSMR TRLEDQVNIP TSGQCSVGGE  420
SEKQNSEAVD VGGGEKVMES ARTLLSIGFE IKQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-25305377274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300490.0KF430049.1 Brassica rapa WRKY transcription factor 32 (WRKY32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108959.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLM4D1B70.0M4D1B7_BRARP; Uncharacterized protein
STRINGBra010266.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32