PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009108712.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 262aa    MW: 29529 Da    PI: 5.4846
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009108712.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.8e-18177210134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+Cgt +Tp+WR gp g+ktLCnaCG+++++ +
  XP_009108712.1 177 CSHCGTNTTPQWRTGPAGPKTLCNACGVRFKSGR 210
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.5E-816262IPR016679Transcription factor, GATA, plant
SMARTSM004017.1E-16171221IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-14174234No hitNo description
Gene3DG3DSA:3.30.50.102.6E-14175208IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.281175207IPR000679Zinc finger, GATA-type
CDDcd002026.71E-16176233No hitNo description
PfamPF003209.0E-16177211IPR000679Zinc finger, GATA-type
PROSITE patternPS003440177202IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MELWTEARAL KASLRGEAIK HQVIVAEDLS RTSSAEDFSV ECFLDFSEEG QERDEEQLVS  60
VCSSQEEQEQ DYCIFSSQPC IFDQLPSLPD EDVEELEWVS RVVDDCSSPE VSLLFTQTLK  120
TKPSFSSSVP VKPRTKRSRN SLTGDRVWPL VSTNQHATGE QCKKKKQETA VLFQRRCSHC  180
GTNTTPQWRT GPAGPKTLCN ACGVRFKSGR LCPEYRPADS PTFSNEIHSN LHRKVMELRK  240
SKELGEERGE ATTKSDQVKF GS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.16590.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527710.0AK352771.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-P20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108712.10.0PREDICTED: GATA transcription factor 3-like
RefseqXP_009108711.10.0PREDICTED: GATA transcription factor 3-like
SwissprotQ8L4M61e-149GATA3_ARATH; GATA transcription factor 3
TrEMBLM4F0P90.0M4F0P9_BRARP; Uncharacterized protein
STRINGBra034644.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.21e-141GATA transcription factor 3