PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009106857.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 260aa    MW: 29042.9 Da    PI: 9.4822
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009106857.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY86.62.2e-27123181159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+W+ YGqK ++g+++ r YY+Ct++gC vkk+ver a++ k ++itY g+H+h+
  XP_009106857.1 123 LDDGYSWKNYGQKLIRGNPNVRRYYKCTFSGCDVKKHVERRADNAKSLVITYYGNHEHD 181
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-28110183IPR003657WRKY domain
SuperFamilySSF1182909.55E-24117183IPR003657WRKY domain
PROSITE profilePS5081128.988118183IPR003657WRKY domain
SMARTSM007741.3E-27123182IPR003657WRKY domain
PfamPF031062.5E-21124180IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MKEVCHVTMG GPVITPKTSA SSIPLIEIAP PSPDAIIGPP EMVESSGGDH ATMMISNNGL  60
PHQRMDVDQA PEDHNIIDVL NVEPSSPKRR GNEVSLSNMI IASRTGRYDE RVIIQMKSEE  120
NNLDDGYSWK NYGQKLIRGN PNVRRYYKCT FSGCDVKKHV ERRADNAKSL VITYYGNHEH  180
DAPVQRRKSY SLKKRSGSPM FQDASNRTPR LGRPPFSSSA FQVFPPSLEP HLGMTQINMN  240
GLSKLPSLPA NQMVHRYTWG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-22114183877Probable WRKY transcription factor 4
2lex_A3e-22114183877Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009106857.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931430.0KM593143.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY40) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106857.10.0PREDICTED: probable WRKY transcription factor 10 isoform X2
TrEMBLA0A3P6BM981e-152A0A3P6BM98_BRACM; Uncharacterized protein
STRINGBo3g185390.11e-145(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55600.19e-34WRKY DNA-binding protein 10