PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009106855.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 203aa    MW: 22761.4 Da    PI: 6.2421
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009106855.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.51.4e-28107165159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+W+KYGq+ + g++++rsYY+Ct+agC vkk+ver a++ k+++itY g+H+h+
  XP_009106855.1 107 LDDGYSWKKYGQRLIMGNQNTRSYYKCTFAGCDVKKHVERRADNVKLLVITYYGNHEHD 165
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-2895167IPR003657WRKY domain
SuperFamilySSF1182909.68E-25101167IPR003657WRKY domain
PROSITE profilePS5081128.334102167IPR003657WRKY domain
SMARTSM007742.1E-28107166IPR003657WRKY domain
PfamPF031062.2E-22108165IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MEMTSYSASQ LIFSIAPPSP DAIIGPPEMV ESSGGNHATM MISNNGLPHQ QMDVDQAPED  60
HNIIDLNVVP SSPKTREDEV SNIIGTLRTG RYNEGVIIQM ESEENNLDDG YSWKKYGQRL  120
IMGNQNTRSY YKCTFAGCDV KKHVERRADN VKLLVITYYG NHEHDAPVQR RKCYSLKKRS  180
GSSMFQDASN RTPRVNSSEG ETV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2398168878Probable WRKY transcription factor 4
2lex_A3e-2398168878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the endosperm of embryo from the two nuclei stage to the late globular embryo stage, including the endosperm cellularization time. {ECO:0000269|PubMed:16293693}.
UniprotTISSUE SPECIFICITY: Expressed in male gametophytes (pollen) and in the endosperm of fertilized ovules. {ECO:0000269|PubMed:16293693}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Modulates seed size by negatively regulating the cellularization of syncytial endosperm (PubMed:16293693). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:16293693}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009106855.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931430.0KM593143.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY40) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106855.11e-153PREDICTED: probable WRKY transcription factor 10
SwissprotQ9LG053e-30WRK10_ARATH; Probable WRKY transcription factor 10
TrEMBLM4EPX71e-151M4EPX7_BRARP; Uncharacterized protein
STRINGBra030848.1-P1e-152(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1951837
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55600.11e-32WRKY DNA-binding protein 10
Publications ? help Back to Top
  1. Li J,Nie X,Tan JL,Berger F
    Integration of epigenetic and genetic controls of seed size by cytokinin in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(38): p. 15479-84
    [PMID:24003120]
  2. Fatihi A,Zbierzak AM,Dörmann P
    Alterations in seed development gene expression affect size and oil content of Arabidopsis seeds.
    Plant Physiol., 2013. 163(2): p. 973-85
    [PMID:24014578]
  3. Liu P, et al.
    Arabidopsis RAN1 mediates seed development through its parental ratio by affecting the onset of endosperm cellularization.
    Mol Plant, 2014. 7(8): p. 1316-1328
    [PMID:24719465]
  4. Xiao YG,Sun QB,Kang XJ,Chen CB,Ni M
    SHORT HYPOCOTYL UNDER BLUE1 or HAIKU2 mixepression alters canola and Arabidopsis seed development.
    New Phytol., 2016. 209(2): p. 636-49
    [PMID:26389843]
  5. Meng LS,Wang YB,Loake GJ,Jiang JH
    Seed Embryo Development Is Regulated via an AN3-MINI3 Gene Cascade.
    Front Plant Sci, 2016. 7: p. 1645
    [PMID:27857719]
  6. Meng LS,Wang YB,Loake GJ,Jiang JH
    Corrigendum: Seed Embryo Development Is Regulated via an AN3-MINI3 Gene Cascade.
    Front Plant Sci, 2017. 8: p. 1073
    [PMID:28616014]