PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009105474.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 294aa    MW: 32518.7 Da    PI: 7.4515
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009105474.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.3e-33151208259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  XP_009105474.1 151 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSRCTVKKRVERSSEDPSIVITTYEGQHCHQ 208
                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-34135209IPR003657WRKY domain
SuperFamilySSF1182902.09E-28142208IPR003657WRKY domain
PROSITE profilePS5081129.838145210IPR003657WRKY domain
SMARTSM007749.6E-39150209IPR003657WRKY domain
PfamPF031063.7E-26151208IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTDPKDPDLS NEDSAWRQLT APDSVFFNRD TSSILSDFGW NLHASSSDNH HNLRFDPCLP  60
PTSTVPSSVT TTATPDPIPA SSHSSTVAAA TASVVSTSNN PSATSSSSEG PTDNSTPKTP  120
ETPKKEKKQA QKRIRQPRFA FMTKSDVDNL EDGYRWRKYG QKAVKNSPFP RSYYRCTNSR  180
CTVKKRVERS SEDPSIVITT YEGQHCHQTI GFPRGGILTA HDPHNFTSHH HHLPLPLPNP  240
YYYQDLHQLH RDSTSSPRLL PQSTTEDGPA AVSSINPSEE GLLGDIVPQT MRNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25140207774Probable WRKY transcription factor 4
2lex_A2e-25140207774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009105474.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300640.0KF430064.1 Brassica rapa WRKY transcription factor 57 (WRKY57) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105473.10.0PREDICTED: probable WRKY transcription factor 57 isoform X1
RefseqXP_009105474.10.0PREDICTED: probable WRKY transcription factor 57 isoform X1
SwissprotQ9C9831e-127WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLM4CJI60.0M4CJI6_BRARP; Uncharacterized protein
STRINGBra004370.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-111WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Jiang Y,Qiu Y,Hu Y,Yu D
    Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa.
    Front Plant Sci, 2016. 7: p. 145
    [PMID:26904091]
  3. Jiang Y,Yu D
    The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
    Plant Physiol., 2016. 171(4): p. 2771-82
    [PMID:27268959]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]