PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009105462.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 301aa    MW: 34231.1 Da    PI: 8.7815
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009105462.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.22.1e-4271146277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv+gC++dls+ k+yh+rh+vCe+hsk++vv+v+g+eqrfCqqCsrfh lsefD++krsCrrrLa+hnerrrk++
  XP_009105462.1  71 CQVHGCNMDLSSSKDYHKRHRVCEAHSKTSVVIVNGVEQRFCQQCSRFHFLSEFDNGKRSCRRRLAGHNERRRKPS 146
                     **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-3464132IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.01868145IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.77E-3969148IPR004333Transcription factor, SBP-box
PfamPF031106.9E-3371144IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDSWSYGTSF LPSDSFPENP RSVAQGLSNE FDKVDDRIDF KVRSFMDYGN YDGNTSSRAK  60
KPRASSRSPL CQVHGCNMDL SSSKDYHKRH RVCEAHSKTS VVIVNGVEQR FCQQCSRFHF  120
LSEFDNGKRS CRRRLAGHNE RRRKPSFYFR HKLLPQGTNS LAGNKVHGRL VSFKDEPMFP  180
AENMSFYSPE AAASGVSSIW DLHEAGPPRS TCACSLLSAQ SQQCLSETNP NKSFSITQPN  240
QTLNHSTIGY HQMLPPPLRT ISSSTVDLQQ LSSHLQRIEQ QQRSFTNDDV KQEYNNELYF  300
P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3164144484squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.202380.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894580.0AC189458.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB073F16, complete sequence.
GenBankAC1892980.0AC189298.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB028I01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105462.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_009105463.10.0PREDICTED: squamosa promoter-binding-like protein 6
SwissprotQ94JW81e-109SPL6_ARATH; Squamosa promoter-binding-like protein 6
TrEMBLM4CJH90.0M4CJH9_BRARP; Uncharacterized protein
STRINGBra004363.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92752435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-95SBP family protein