PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009104596.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 374aa    MW: 42314.5 Da    PI: 6.6552
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009104596.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.23.2e-1288138454
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     +k  rr+++NReAAr+sR+RKka++++Lee   +L++  ++L k  ++ +k
  XP_009104596.1  88 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELEKAKQQVSK 138
                     7999**************************999999999877766666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-880137No hitNo description
SMARTSM003382.9E-580138IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.55387138IPR004827Basic-leucine zipper domain
PfamPF001701.8E-888139IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.44E-789135No hitNo description
PROSITE patternPS00036092107IPR004827Basic-leucine zipper domain
PfamPF141441.0E-28176250IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MMSSTSPTQL ASLRDMGIYE PFQQMVSWGN VFKSDINDHS PNTASSSVIQ VDHNIIKASY  60
PSSSHNQIEA EPSSNDHQEE DDDGRNHDKM KRRLAQNREA ARKSRLRKKA YVQQLEESRL  120
KLSQLEQELE KAKQQVSKGI YSSGSSYVGS SGSINSSIAA FELEYSHWLE EQSRRVSEIR  180
TALQAHISDI ELKMLVESCL NHYANLFRMK ADAAKADVFY LISGMWRTST ERFFQWIGGF  240
RPSGLLNVVM PYLQPLTDQQ ILEVRNLQQS SQQAEDALSQ GIDKLQQSLA DNIVIDVVMD  300
SNDYPSHMGA AVENLQALEG FVNQADHLRQ QTLQQMAKIL TTRQAARGLL CLGEYLHRLR  360
ALSSLWAARP REHA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009104596.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533840.0AK353384.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104596.10.0PREDICTED: transcription factor TGA7-like isoform X1
RefseqXP_013648665.10.0transcription factor TGA7-like isoform X1
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A3N6THZ50.0A0A3N6THZ5_BRACR; Uncharacterized protein
STRINGXP_010416756.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]